Cargando…

Pathogenic variants carrier screening in New Brunswick: Acadians reveal high carrier frequency for multiple genetic disorders

BACKGROUND: Founder populations that have recently undergone important genetic bottlenecks such as French-Canadians and Ashkenazi Jews can harbor some pathogenic variants at a higher carrier rate than the general population, putting them at a higher risk for certain genetic diseases. In these popula...

Descripción completa

Detalles Bibliográficos
Autores principales: Robichaud, Philippe Pierre, Allain, Eric P., Belbraouet, Sarah, Bhérer, Claude, Mamelona, Jean, Harquail, Jason, Crapoulet, Stéphanie, Crapoulet, Nicolas, Bélanger, Mathieu, Ben Amor, Mouna
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2022
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9055701/
https://www.ncbi.nlm.nih.gov/pubmed/35488281
http://dx.doi.org/10.1186/s12920-022-01249-1
_version_ 1784697472722927616
author Robichaud, Philippe Pierre
Allain, Eric P.
Belbraouet, Sarah
Bhérer, Claude
Mamelona, Jean
Harquail, Jason
Crapoulet, Stéphanie
Crapoulet, Nicolas
Bélanger, Mathieu
Ben Amor, Mouna
author_facet Robichaud, Philippe Pierre
Allain, Eric P.
Belbraouet, Sarah
Bhérer, Claude
Mamelona, Jean
Harquail, Jason
Crapoulet, Stéphanie
Crapoulet, Nicolas
Bélanger, Mathieu
Ben Amor, Mouna
author_sort Robichaud, Philippe Pierre
collection PubMed
description BACKGROUND: Founder populations that have recently undergone important genetic bottlenecks such as French-Canadians and Ashkenazi Jews can harbor some pathogenic variants at a higher carrier rate than the general population, putting them at a higher risk for certain genetic diseases. In these populations, there can be considerable benefit to performing ethnic-based or expanded preconception carrier screening, which can help in the prevention or early diagnosis and management of some genetic diseases. Acadians are descendants of French immigrants who settled in the Atlantic Coast of Canada in the seventeenth century. Yet, the Acadian population has never been investigated for the prevalence/frequency of disease-causing genetic variants. METHODS: An exome sequencing panel for 312 autosomal recessive and 30 X-linked diseases was designed and specimens from 60 healthy participants were sequenced to assess carrier frequency for the targeted diseases. RESULTS: In this study, we show that a sample population of Acadians in South-East New Brunswick harbor variants for 28 autosomal recessive and 1 X-linked diseases, some of which are significantly more frequent in comparison to reference populations. CONCLUSION: Results from this pilot study suggests a need for further investigation of genomic variation in this population and possibly implementation of targeted carrier and neonatal screening programs. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12920-022-01249-1.
format Online
Article
Text
id pubmed-9055701
institution National Center for Biotechnology Information
language English
publishDate 2022
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-90557012022-05-01 Pathogenic variants carrier screening in New Brunswick: Acadians reveal high carrier frequency for multiple genetic disorders Robichaud, Philippe Pierre Allain, Eric P. Belbraouet, Sarah Bhérer, Claude Mamelona, Jean Harquail, Jason Crapoulet, Stéphanie Crapoulet, Nicolas Bélanger, Mathieu Ben Amor, Mouna BMC Med Genomics Research BACKGROUND: Founder populations that have recently undergone important genetic bottlenecks such as French-Canadians and Ashkenazi Jews can harbor some pathogenic variants at a higher carrier rate than the general population, putting them at a higher risk for certain genetic diseases. In these populations, there can be considerable benefit to performing ethnic-based or expanded preconception carrier screening, which can help in the prevention or early diagnosis and management of some genetic diseases. Acadians are descendants of French immigrants who settled in the Atlantic Coast of Canada in the seventeenth century. Yet, the Acadian population has never been investigated for the prevalence/frequency of disease-causing genetic variants. METHODS: An exome sequencing panel for 312 autosomal recessive and 30 X-linked diseases was designed and specimens from 60 healthy participants were sequenced to assess carrier frequency for the targeted diseases. RESULTS: In this study, we show that a sample population of Acadians in South-East New Brunswick harbor variants for 28 autosomal recessive and 1 X-linked diseases, some of which are significantly more frequent in comparison to reference populations. CONCLUSION: Results from this pilot study suggests a need for further investigation of genomic variation in this population and possibly implementation of targeted carrier and neonatal screening programs. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12920-022-01249-1. BioMed Central 2022-04-29 /pmc/articles/PMC9055701/ /pubmed/35488281 http://dx.doi.org/10.1186/s12920-022-01249-1 Text en © The Author(s) 2022 https://creativecommons.org/licenses/by/4.0/Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data.
spellingShingle Research
Robichaud, Philippe Pierre
Allain, Eric P.
Belbraouet, Sarah
Bhérer, Claude
Mamelona, Jean
Harquail, Jason
Crapoulet, Stéphanie
Crapoulet, Nicolas
Bélanger, Mathieu
Ben Amor, Mouna
Pathogenic variants carrier screening in New Brunswick: Acadians reveal high carrier frequency for multiple genetic disorders
title Pathogenic variants carrier screening in New Brunswick: Acadians reveal high carrier frequency for multiple genetic disorders
title_full Pathogenic variants carrier screening in New Brunswick: Acadians reveal high carrier frequency for multiple genetic disorders
title_fullStr Pathogenic variants carrier screening in New Brunswick: Acadians reveal high carrier frequency for multiple genetic disorders
title_full_unstemmed Pathogenic variants carrier screening in New Brunswick: Acadians reveal high carrier frequency for multiple genetic disorders
title_short Pathogenic variants carrier screening in New Brunswick: Acadians reveal high carrier frequency for multiple genetic disorders
title_sort pathogenic variants carrier screening in new brunswick: acadians reveal high carrier frequency for multiple genetic disorders
topic Research
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9055701/
https://www.ncbi.nlm.nih.gov/pubmed/35488281
http://dx.doi.org/10.1186/s12920-022-01249-1
work_keys_str_mv AT robichaudphilippepierre pathogenicvariantscarrierscreeninginnewbrunswickacadiansrevealhighcarrierfrequencyformultiplegeneticdisorders
AT allainericp pathogenicvariantscarrierscreeninginnewbrunswickacadiansrevealhighcarrierfrequencyformultiplegeneticdisorders
AT belbraouetsarah pathogenicvariantscarrierscreeninginnewbrunswickacadiansrevealhighcarrierfrequencyformultiplegeneticdisorders
AT bhererclaude pathogenicvariantscarrierscreeninginnewbrunswickacadiansrevealhighcarrierfrequencyformultiplegeneticdisorders
AT mamelonajean pathogenicvariantscarrierscreeninginnewbrunswickacadiansrevealhighcarrierfrequencyformultiplegeneticdisorders
AT harquailjason pathogenicvariantscarrierscreeninginnewbrunswickacadiansrevealhighcarrierfrequencyformultiplegeneticdisorders
AT crapouletstephanie pathogenicvariantscarrierscreeninginnewbrunswickacadiansrevealhighcarrierfrequencyformultiplegeneticdisorders
AT crapouletnicolas pathogenicvariantscarrierscreeninginnewbrunswickacadiansrevealhighcarrierfrequencyformultiplegeneticdisorders
AT belangermathieu pathogenicvariantscarrierscreeninginnewbrunswickacadiansrevealhighcarrierfrequencyformultiplegeneticdisorders
AT benamormouna pathogenicvariantscarrierscreeninginnewbrunswickacadiansrevealhighcarrierfrequencyformultiplegeneticdisorders