Cargando…

Imagery ability assessments: a cross-disciplinary systematic review and quality evaluation of psychometric properties

BACKGROUND: Over the last two centuries, researchers developed several assessments to evaluate the multidimensional construct of imagery. However, no comprehensive systematic review (SR) exists for imagery ability evaluation methods and an in-depth quality evaluation of their psychometric properties...

Descripción completa

Detalles Bibliográficos
Autores principales: Suica, Zorica, Behrendt, Frank, Gäumann, Szabina, Gerth, Ulrich, Schmidt-Trucksäss, Arno, Ettlin, Thierry, Schuster-Amft, Corina
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2022
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9059408/
https://www.ncbi.nlm.nih.gov/pubmed/35491422
http://dx.doi.org/10.1186/s12916-022-02295-3
_version_ 1784698306005303296
author Suica, Zorica
Behrendt, Frank
Gäumann, Szabina
Gerth, Ulrich
Schmidt-Trucksäss, Arno
Ettlin, Thierry
Schuster-Amft, Corina
author_facet Suica, Zorica
Behrendt, Frank
Gäumann, Szabina
Gerth, Ulrich
Schmidt-Trucksäss, Arno
Ettlin, Thierry
Schuster-Amft, Corina
author_sort Suica, Zorica
collection PubMed
description BACKGROUND: Over the last two centuries, researchers developed several assessments to evaluate the multidimensional construct of imagery. However, no comprehensive systematic review (SR) exists for imagery ability evaluation methods and an in-depth quality evaluation of their psychometric properties. METHODS: We performed a comprehensive systematic search in six databases in the disciplines of sport, psychology, medicine, education: SPORTDiscus, PsycINFO, Cochrane Library, Scopus, Web of Science, and ERIC. Two reviewers independently identified and screened articles for selection. COSMIN checklist was used to evaluate the methodological quality of the studies. All included assessments were evaluated for quality using criteria for good measurement properties. The evidence synthesis was summarised by using the GRADE approach. RESULTS: In total, 121 articles reporting 155 studies and describing 65 assessments were included. We categorised assessments based on their construct on: (1) motor imagery (n = 15), (2) mental imagery (n = 48) and (3) mental chronometry (n = 2). Methodological quality of studies was mainly doubtful or inadequate. The psychometric properties of most assessments were insufficient or indeterminate. The best rated assessments with sufficient psychometric properties were MIQ, MIQ-R, MIQ-3, and VMIQ-2 for evaluation of motor imagery ability. Regarding mental imagery evaluation, only SIAQ and VVIQ showed sufficient psychometric properties. CONCLUSION: Various assessments exist to evaluate an individual’s imagery ability within different dimensions or modalities of imagery in different disciplines. However, the psychometric properties of most assessments are insufficient or indeterminate. Several assessments should be revised and further validated. Moreover, most studies were only evaluated with students. Further cross-disciplinary validation studies are needed including older populations with a larger age range. Our findings allow clinicians, coaches, teachers, and researchers to select a suitable imagery ability assessment for their setting and goals based on information about the focus and quality of the assessments. SYSTEMATIC REVIEWS REGISTER: PROSPERO CRD42017077004. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12916-022-02295-3.
format Online
Article
Text
id pubmed-9059408
institution National Center for Biotechnology Information
language English
publishDate 2022
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-90594082022-05-03 Imagery ability assessments: a cross-disciplinary systematic review and quality evaluation of psychometric properties Suica, Zorica Behrendt, Frank Gäumann, Szabina Gerth, Ulrich Schmidt-Trucksäss, Arno Ettlin, Thierry Schuster-Amft, Corina BMC Med Research Article BACKGROUND: Over the last two centuries, researchers developed several assessments to evaluate the multidimensional construct of imagery. However, no comprehensive systematic review (SR) exists for imagery ability evaluation methods and an in-depth quality evaluation of their psychometric properties. METHODS: We performed a comprehensive systematic search in six databases in the disciplines of sport, psychology, medicine, education: SPORTDiscus, PsycINFO, Cochrane Library, Scopus, Web of Science, and ERIC. Two reviewers independently identified and screened articles for selection. COSMIN checklist was used to evaluate the methodological quality of the studies. All included assessments were evaluated for quality using criteria for good measurement properties. The evidence synthesis was summarised by using the GRADE approach. RESULTS: In total, 121 articles reporting 155 studies and describing 65 assessments were included. We categorised assessments based on their construct on: (1) motor imagery (n = 15), (2) mental imagery (n = 48) and (3) mental chronometry (n = 2). Methodological quality of studies was mainly doubtful or inadequate. The psychometric properties of most assessments were insufficient or indeterminate. The best rated assessments with sufficient psychometric properties were MIQ, MIQ-R, MIQ-3, and VMIQ-2 for evaluation of motor imagery ability. Regarding mental imagery evaluation, only SIAQ and VVIQ showed sufficient psychometric properties. CONCLUSION: Various assessments exist to evaluate an individual’s imagery ability within different dimensions or modalities of imagery in different disciplines. However, the psychometric properties of most assessments are insufficient or indeterminate. Several assessments should be revised and further validated. Moreover, most studies were only evaluated with students. Further cross-disciplinary validation studies are needed including older populations with a larger age range. Our findings allow clinicians, coaches, teachers, and researchers to select a suitable imagery ability assessment for their setting and goals based on information about the focus and quality of the assessments. SYSTEMATIC REVIEWS REGISTER: PROSPERO CRD42017077004. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12916-022-02295-3. BioMed Central 2022-05-02 /pmc/articles/PMC9059408/ /pubmed/35491422 http://dx.doi.org/10.1186/s12916-022-02295-3 Text en © The Author(s) 2022 https://creativecommons.org/licenses/by/4.0/Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data.
spellingShingle Research Article
Suica, Zorica
Behrendt, Frank
Gäumann, Szabina
Gerth, Ulrich
Schmidt-Trucksäss, Arno
Ettlin, Thierry
Schuster-Amft, Corina
Imagery ability assessments: a cross-disciplinary systematic review and quality evaluation of psychometric properties
title Imagery ability assessments: a cross-disciplinary systematic review and quality evaluation of psychometric properties
title_full Imagery ability assessments: a cross-disciplinary systematic review and quality evaluation of psychometric properties
title_fullStr Imagery ability assessments: a cross-disciplinary systematic review and quality evaluation of psychometric properties
title_full_unstemmed Imagery ability assessments: a cross-disciplinary systematic review and quality evaluation of psychometric properties
title_short Imagery ability assessments: a cross-disciplinary systematic review and quality evaluation of psychometric properties
title_sort imagery ability assessments: a cross-disciplinary systematic review and quality evaluation of psychometric properties
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9059408/
https://www.ncbi.nlm.nih.gov/pubmed/35491422
http://dx.doi.org/10.1186/s12916-022-02295-3
work_keys_str_mv AT suicazorica imageryabilityassessmentsacrossdisciplinarysystematicreviewandqualityevaluationofpsychometricproperties
AT behrendtfrank imageryabilityassessmentsacrossdisciplinarysystematicreviewandqualityevaluationofpsychometricproperties
AT gaumannszabina imageryabilityassessmentsacrossdisciplinarysystematicreviewandqualityevaluationofpsychometricproperties
AT gerthulrich imageryabilityassessmentsacrossdisciplinarysystematicreviewandqualityevaluationofpsychometricproperties
AT schmidttrucksassarno imageryabilityassessmentsacrossdisciplinarysystematicreviewandqualityevaluationofpsychometricproperties
AT ettlinthierry imageryabilityassessmentsacrossdisciplinarysystematicreviewandqualityevaluationofpsychometricproperties
AT schusteramftcorina imageryabilityassessmentsacrossdisciplinarysystematicreviewandqualityevaluationofpsychometricproperties