Cargando…
Abstract 155: Vitamin D dependent rickets type II: Our experience and systematic review
Background: Hereditary vitamin D resistant rickets, is a rare autosomal recessive disease caused by variants affecting VDR gene. We aimed to describe our experience and systematically review the world literature. Objective: To evaluate the phenotypic and genotypic spectrum of VDDR2. Methods: The cli...
Autor principal: | |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Wolters Kluwer - Medknow
2022
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9067715/ http://dx.doi.org/10.4103/2230-8210.342280 |
_version_ | 1784700066564407296 |
---|---|
author | Manjunath, |
author_facet | Manjunath, |
author_sort | Manjunath, |
collection | PubMed |
description | Background: Hereditary vitamin D resistant rickets, is a rare autosomal recessive disease caused by variants affecting VDR gene. We aimed to describe our experience and systematically review the world literature. Objective: To evaluate the phenotypic and genotypic spectrum of VDDR2. Methods: The clinical and genetic spectrum of VDDR2 were analyzed. Results: Six patients of VDDR 2 were included. The mean age at the development of rachitic changes was 12±3.79 months. Baseline biochemistry revealed hypocalcemia (6.67±1.5 mg/dl), hypophosphatemia (3±1.5 mg/dl) with elevated serum alkaline phosphatase (3579±845 IU/ml) and PTH (372±183 pg/ml). Three novels variants in VDR gene were detected (p.N444D=1, p.I268T=1, p.H85R=1, p.H355TfsTer7=1). A systematic review (probands 112) revealed alopecia in majority of patients (81.2%). Complete response to oral therapy with supra-physiological dose of calcitriol and high dose of oral calcium was observed in 32.5% of cases. Recurrent variants specific to geographical locations were p.Lys45Glu (Africa); p.Cys41Tyr, p.Gln152Ter (Asia); p.Gln356Ter (Europe); p.Gln259Glu (Latino). Patients with variants in ligand binding domain (LBD) had better response to oral therapy compared to cases with DBD variants. Conclusion: Patients with VDDR2 presents in infancy with alopecia. Higher complete response rate to oral therapy can be anticipated in cases with variants affecting LBD. |
format | Online Article Text |
id | pubmed-9067715 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2022 |
publisher | Wolters Kluwer - Medknow |
record_format | MEDLINE/PubMed |
spelling | pubmed-90677152022-05-05 Abstract 155: Vitamin D dependent rickets type II: Our experience and systematic review Manjunath, Indian J Endocrinol Metab Abstracts … Esicon 2021 Background: Hereditary vitamin D resistant rickets, is a rare autosomal recessive disease caused by variants affecting VDR gene. We aimed to describe our experience and systematically review the world literature. Objective: To evaluate the phenotypic and genotypic spectrum of VDDR2. Methods: The clinical and genetic spectrum of VDDR2 were analyzed. Results: Six patients of VDDR 2 were included. The mean age at the development of rachitic changes was 12±3.79 months. Baseline biochemistry revealed hypocalcemia (6.67±1.5 mg/dl), hypophosphatemia (3±1.5 mg/dl) with elevated serum alkaline phosphatase (3579±845 IU/ml) and PTH (372±183 pg/ml). Three novels variants in VDR gene were detected (p.N444D=1, p.I268T=1, p.H85R=1, p.H355TfsTer7=1). A systematic review (probands 112) revealed alopecia in majority of patients (81.2%). Complete response to oral therapy with supra-physiological dose of calcitriol and high dose of oral calcium was observed in 32.5% of cases. Recurrent variants specific to geographical locations were p.Lys45Glu (Africa); p.Cys41Tyr, p.Gln152Ter (Asia); p.Gln356Ter (Europe); p.Gln259Glu (Latino). Patients with variants in ligand binding domain (LBD) had better response to oral therapy compared to cases with DBD variants. Conclusion: Patients with VDDR2 presents in infancy with alopecia. Higher complete response rate to oral therapy can be anticipated in cases with variants affecting LBD. Wolters Kluwer - Medknow 2022-03 /pmc/articles/PMC9067715/ http://dx.doi.org/10.4103/2230-8210.342280 Text en Copyright: © 2022 Indian Journal of Endocrinology and Metabolism https://creativecommons.org/licenses/by-nc-sa/4.0/This is an open access journal, and articles are distributed under the terms of the Creative Commons Attribution-NonCommercial-ShareAlike 4.0 License, which allows others to remix, tweak, and build upon the work non-commercially, as long as appropriate credit is given and the new creations are licensed under the identical terms. |
spellingShingle | Abstracts … Esicon 2021 Manjunath, Abstract 155: Vitamin D dependent rickets type II: Our experience and systematic review |
title | Abstract 155: Vitamin D dependent rickets type II: Our experience and systematic review |
title_full | Abstract 155: Vitamin D dependent rickets type II: Our experience and systematic review |
title_fullStr | Abstract 155: Vitamin D dependent rickets type II: Our experience and systematic review |
title_full_unstemmed | Abstract 155: Vitamin D dependent rickets type II: Our experience and systematic review |
title_short | Abstract 155: Vitamin D dependent rickets type II: Our experience and systematic review |
title_sort | abstract 155: vitamin d dependent rickets type ii: our experience and systematic review |
topic | Abstracts … Esicon 2021 |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9067715/ http://dx.doi.org/10.4103/2230-8210.342280 |
work_keys_str_mv | AT manjunath abstract155vitaminddependentricketstypeiiourexperienceandsystematicreview |