Cargando…
Airway epithelial stem cell chimerism in cystic fibrosis lung transplant recipients
BACKGROUND: The conducting airway epithelium is repaired by tissue specific stem cells (TSC). In response to mild/moderate injury, each TSC repairs a discrete area of the epithelium. In contrast, severe epithelial injury stimulates TSC migration and expands the stem cell’s reparative domain. Lung tr...
Autores principales: | , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
2021
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9078212/ https://www.ncbi.nlm.nih.gov/pubmed/33187933 http://dx.doi.org/10.1016/j.jcf.2020.09.013 |
_version_ | 1784702278943375360 |
---|---|
author | Hayes, Don Rayner, Rachael E. Hill, Cynthia L. Alsudayri, Alfahdah Tadesse, Mahelet Lallier, Scott W. Parekh, Hemant Brock, Guy N. Cormet-Boyaka, Estelle Reynolds, Susan D. |
author_facet | Hayes, Don Rayner, Rachael E. Hill, Cynthia L. Alsudayri, Alfahdah Tadesse, Mahelet Lallier, Scott W. Parekh, Hemant Brock, Guy N. Cormet-Boyaka, Estelle Reynolds, Susan D. |
author_sort | Hayes, Don |
collection | PubMed |
description | BACKGROUND: The conducting airway epithelium is repaired by tissue specific stem cells (TSC). In response to mild/moderate injury, each TSC repairs a discrete area of the epithelium. In contrast, severe epithelial injury stimulates TSC migration and expands the stem cell’s reparative domain. Lung transplantation (LTx) can cause a moderate/severe airway injury and the remodeled airway contains a chimeric mixture of donor and recipient cells. These studies supported the hypothesis, LTx stimulates TSC migration resulting in epithelial chimerism. We tested this hypothesis in cystic fibrosis (CF) LTx patients. METHODS: Airway mucosal injury was quantified using bronchoscopic imaging and a novel grading system. Bronchial brushing was used to recover TSC from 10 sites in the recipient and allograft airways. TSC chimerism was quantified by short tandem repeat analysis. TSC self-renewal and differentiation potential were assayed using the clone forming cell frequency and air-liquid-interface methods. Electrophysiology was used to determine if TSC chimerism altered epithelial ion channel activity. RESULTS: LTx caused a mild to moderate airway mucosal injury. Donor and recipient TSC were identified in 91% of anastomotic sites and 93% of bronchial airways. TSC chimerism did not alter stem cell self-renewal or differentiation potential. The frequency of recipient TSC was proportional to CF Transmembrane Conductance Regulator (CFTR)-dependent ion channel activity and 33% of allograft regions were at risk for abnormal CFTR activity. CONCLUSIONS: LTx in CF patients stimulates bidirectional TSC migration across the anastomoses. TSC chimerism may alter ion homeostasis and compromise the host defense capability of the allograft airway epithelium. |
format | Online Article Text |
id | pubmed-9078212 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2021 |
record_format | MEDLINE/PubMed |
spelling | pubmed-90782122022-05-07 Airway epithelial stem cell chimerism in cystic fibrosis lung transplant recipients Hayes, Don Rayner, Rachael E. Hill, Cynthia L. Alsudayri, Alfahdah Tadesse, Mahelet Lallier, Scott W. Parekh, Hemant Brock, Guy N. Cormet-Boyaka, Estelle Reynolds, Susan D. J Cyst Fibros Article BACKGROUND: The conducting airway epithelium is repaired by tissue specific stem cells (TSC). In response to mild/moderate injury, each TSC repairs a discrete area of the epithelium. In contrast, severe epithelial injury stimulates TSC migration and expands the stem cell’s reparative domain. Lung transplantation (LTx) can cause a moderate/severe airway injury and the remodeled airway contains a chimeric mixture of donor and recipient cells. These studies supported the hypothesis, LTx stimulates TSC migration resulting in epithelial chimerism. We tested this hypothesis in cystic fibrosis (CF) LTx patients. METHODS: Airway mucosal injury was quantified using bronchoscopic imaging and a novel grading system. Bronchial brushing was used to recover TSC from 10 sites in the recipient and allograft airways. TSC chimerism was quantified by short tandem repeat analysis. TSC self-renewal and differentiation potential were assayed using the clone forming cell frequency and air-liquid-interface methods. Electrophysiology was used to determine if TSC chimerism altered epithelial ion channel activity. RESULTS: LTx caused a mild to moderate airway mucosal injury. Donor and recipient TSC were identified in 91% of anastomotic sites and 93% of bronchial airways. TSC chimerism did not alter stem cell self-renewal or differentiation potential. The frequency of recipient TSC was proportional to CF Transmembrane Conductance Regulator (CFTR)-dependent ion channel activity and 33% of allograft regions were at risk for abnormal CFTR activity. CONCLUSIONS: LTx in CF patients stimulates bidirectional TSC migration across the anastomoses. TSC chimerism may alter ion homeostasis and compromise the host defense capability of the allograft airway epithelium. 2021-01 2020-11-10 /pmc/articles/PMC9078212/ /pubmed/33187933 http://dx.doi.org/10.1016/j.jcf.2020.09.013 Text en https://creativecommons.org/licenses/by-nc-nd/4.0/This is an open access article under the CC BY-NC-ND license (http://creativecommons.org/licenses/by-nc-nd/4.0/ (https://creativecommons.org/licenses/by-nc-nd/4.0/) ) |
spellingShingle | Article Hayes, Don Rayner, Rachael E. Hill, Cynthia L. Alsudayri, Alfahdah Tadesse, Mahelet Lallier, Scott W. Parekh, Hemant Brock, Guy N. Cormet-Boyaka, Estelle Reynolds, Susan D. Airway epithelial stem cell chimerism in cystic fibrosis lung transplant recipients |
title | Airway epithelial stem cell chimerism in cystic fibrosis lung transplant recipients |
title_full | Airway epithelial stem cell chimerism in cystic fibrosis lung transplant recipients |
title_fullStr | Airway epithelial stem cell chimerism in cystic fibrosis lung transplant recipients |
title_full_unstemmed | Airway epithelial stem cell chimerism in cystic fibrosis lung transplant recipients |
title_short | Airway epithelial stem cell chimerism in cystic fibrosis lung transplant recipients |
title_sort | airway epithelial stem cell chimerism in cystic fibrosis lung transplant recipients |
topic | Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9078212/ https://www.ncbi.nlm.nih.gov/pubmed/33187933 http://dx.doi.org/10.1016/j.jcf.2020.09.013 |
work_keys_str_mv | AT hayesdon airwayepithelialstemcellchimerismincysticfibrosislungtransplantrecipients AT raynerrachaele airwayepithelialstemcellchimerismincysticfibrosislungtransplantrecipients AT hillcynthial airwayepithelialstemcellchimerismincysticfibrosislungtransplantrecipients AT alsudayrialfahdah airwayepithelialstemcellchimerismincysticfibrosislungtransplantrecipients AT tadessemahelet airwayepithelialstemcellchimerismincysticfibrosislungtransplantrecipients AT lallierscottw airwayepithelialstemcellchimerismincysticfibrosislungtransplantrecipients AT parekhhemant airwayepithelialstemcellchimerismincysticfibrosislungtransplantrecipients AT brockguyn airwayepithelialstemcellchimerismincysticfibrosislungtransplantrecipients AT cormetboyakaestelle airwayepithelialstemcellchimerismincysticfibrosislungtransplantrecipients AT reynoldssusand airwayepithelialstemcellchimerismincysticfibrosislungtransplantrecipients |