Cargando…

Airway epithelial stem cell chimerism in cystic fibrosis lung transplant recipients

BACKGROUND: The conducting airway epithelium is repaired by tissue specific stem cells (TSC). In response to mild/moderate injury, each TSC repairs a discrete area of the epithelium. In contrast, severe epithelial injury stimulates TSC migration and expands the stem cell’s reparative domain. Lung tr...

Descripción completa

Detalles Bibliográficos
Autores principales: Hayes, Don, Rayner, Rachael E., Hill, Cynthia L., Alsudayri, Alfahdah, Tadesse, Mahelet, Lallier, Scott W., Parekh, Hemant, Brock, Guy N., Cormet-Boyaka, Estelle, Reynolds, Susan D.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: 2021
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9078212/
https://www.ncbi.nlm.nih.gov/pubmed/33187933
http://dx.doi.org/10.1016/j.jcf.2020.09.013
_version_ 1784702278943375360
author Hayes, Don
Rayner, Rachael E.
Hill, Cynthia L.
Alsudayri, Alfahdah
Tadesse, Mahelet
Lallier, Scott W.
Parekh, Hemant
Brock, Guy N.
Cormet-Boyaka, Estelle
Reynolds, Susan D.
author_facet Hayes, Don
Rayner, Rachael E.
Hill, Cynthia L.
Alsudayri, Alfahdah
Tadesse, Mahelet
Lallier, Scott W.
Parekh, Hemant
Brock, Guy N.
Cormet-Boyaka, Estelle
Reynolds, Susan D.
author_sort Hayes, Don
collection PubMed
description BACKGROUND: The conducting airway epithelium is repaired by tissue specific stem cells (TSC). In response to mild/moderate injury, each TSC repairs a discrete area of the epithelium. In contrast, severe epithelial injury stimulates TSC migration and expands the stem cell’s reparative domain. Lung transplantation (LTx) can cause a moderate/severe airway injury and the remodeled airway contains a chimeric mixture of donor and recipient cells. These studies supported the hypothesis, LTx stimulates TSC migration resulting in epithelial chimerism. We tested this hypothesis in cystic fibrosis (CF) LTx patients. METHODS: Airway mucosal injury was quantified using bronchoscopic imaging and a novel grading system. Bronchial brushing was used to recover TSC from 10 sites in the recipient and allograft airways. TSC chimerism was quantified by short tandem repeat analysis. TSC self-renewal and differentiation potential were assayed using the clone forming cell frequency and air-liquid-interface methods. Electrophysiology was used to determine if TSC chimerism altered epithelial ion channel activity. RESULTS: LTx caused a mild to moderate airway mucosal injury. Donor and recipient TSC were identified in 91% of anastomotic sites and 93% of bronchial airways. TSC chimerism did not alter stem cell self-renewal or differentiation potential. The frequency of recipient TSC was proportional to CF Transmembrane Conductance Regulator (CFTR)-dependent ion channel activity and 33% of allograft regions were at risk for abnormal CFTR activity. CONCLUSIONS: LTx in CF patients stimulates bidirectional TSC migration across the anastomoses. TSC chimerism may alter ion homeostasis and compromise the host defense capability of the allograft airway epithelium.
format Online
Article
Text
id pubmed-9078212
institution National Center for Biotechnology Information
language English
publishDate 2021
record_format MEDLINE/PubMed
spelling pubmed-90782122022-05-07 Airway epithelial stem cell chimerism in cystic fibrosis lung transplant recipients Hayes, Don Rayner, Rachael E. Hill, Cynthia L. Alsudayri, Alfahdah Tadesse, Mahelet Lallier, Scott W. Parekh, Hemant Brock, Guy N. Cormet-Boyaka, Estelle Reynolds, Susan D. J Cyst Fibros Article BACKGROUND: The conducting airway epithelium is repaired by tissue specific stem cells (TSC). In response to mild/moderate injury, each TSC repairs a discrete area of the epithelium. In contrast, severe epithelial injury stimulates TSC migration and expands the stem cell’s reparative domain. Lung transplantation (LTx) can cause a moderate/severe airway injury and the remodeled airway contains a chimeric mixture of donor and recipient cells. These studies supported the hypothesis, LTx stimulates TSC migration resulting in epithelial chimerism. We tested this hypothesis in cystic fibrosis (CF) LTx patients. METHODS: Airway mucosal injury was quantified using bronchoscopic imaging and a novel grading system. Bronchial brushing was used to recover TSC from 10 sites in the recipient and allograft airways. TSC chimerism was quantified by short tandem repeat analysis. TSC self-renewal and differentiation potential were assayed using the clone forming cell frequency and air-liquid-interface methods. Electrophysiology was used to determine if TSC chimerism altered epithelial ion channel activity. RESULTS: LTx caused a mild to moderate airway mucosal injury. Donor and recipient TSC were identified in 91% of anastomotic sites and 93% of bronchial airways. TSC chimerism did not alter stem cell self-renewal or differentiation potential. The frequency of recipient TSC was proportional to CF Transmembrane Conductance Regulator (CFTR)-dependent ion channel activity and 33% of allograft regions were at risk for abnormal CFTR activity. CONCLUSIONS: LTx in CF patients stimulates bidirectional TSC migration across the anastomoses. TSC chimerism may alter ion homeostasis and compromise the host defense capability of the allograft airway epithelium. 2021-01 2020-11-10 /pmc/articles/PMC9078212/ /pubmed/33187933 http://dx.doi.org/10.1016/j.jcf.2020.09.013 Text en https://creativecommons.org/licenses/by-nc-nd/4.0/This is an open access article under the CC BY-NC-ND license (http://creativecommons.org/licenses/by-nc-nd/4.0/ (https://creativecommons.org/licenses/by-nc-nd/4.0/) )
spellingShingle Article
Hayes, Don
Rayner, Rachael E.
Hill, Cynthia L.
Alsudayri, Alfahdah
Tadesse, Mahelet
Lallier, Scott W.
Parekh, Hemant
Brock, Guy N.
Cormet-Boyaka, Estelle
Reynolds, Susan D.
Airway epithelial stem cell chimerism in cystic fibrosis lung transplant recipients
title Airway epithelial stem cell chimerism in cystic fibrosis lung transplant recipients
title_full Airway epithelial stem cell chimerism in cystic fibrosis lung transplant recipients
title_fullStr Airway epithelial stem cell chimerism in cystic fibrosis lung transplant recipients
title_full_unstemmed Airway epithelial stem cell chimerism in cystic fibrosis lung transplant recipients
title_short Airway epithelial stem cell chimerism in cystic fibrosis lung transplant recipients
title_sort airway epithelial stem cell chimerism in cystic fibrosis lung transplant recipients
topic Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9078212/
https://www.ncbi.nlm.nih.gov/pubmed/33187933
http://dx.doi.org/10.1016/j.jcf.2020.09.013
work_keys_str_mv AT hayesdon airwayepithelialstemcellchimerismincysticfibrosislungtransplantrecipients
AT raynerrachaele airwayepithelialstemcellchimerismincysticfibrosislungtransplantrecipients
AT hillcynthial airwayepithelialstemcellchimerismincysticfibrosislungtransplantrecipients
AT alsudayrialfahdah airwayepithelialstemcellchimerismincysticfibrosislungtransplantrecipients
AT tadessemahelet airwayepithelialstemcellchimerismincysticfibrosislungtransplantrecipients
AT lallierscottw airwayepithelialstemcellchimerismincysticfibrosislungtransplantrecipients
AT parekhhemant airwayepithelialstemcellchimerismincysticfibrosislungtransplantrecipients
AT brockguyn airwayepithelialstemcellchimerismincysticfibrosislungtransplantrecipients
AT cormetboyakaestelle airwayepithelialstemcellchimerismincysticfibrosislungtransplantrecipients
AT reynoldssusand airwayepithelialstemcellchimerismincysticfibrosislungtransplantrecipients