Cargando…

CPAP-induced Airway Hyper-reactivity in Mice is Modulated by Hyaluronan Synthase-3

BACKGROUND: Continuous positive airway pressure (CPAP) is a primary mode of respiratory support for preterm infants. Animal studies have shown long-term detrimental effects on lung/airway development, particularly airway (AW) hyper-reactivity, as an unfortunate consequence of neonatal CPAP. Since th...

Descripción completa

Detalles Bibliográficos
Autores principales: Mayer, Catherine A, Ganguli, Abhrajit, Mayer, Aubrey, Pabelick, Christina M, Prakash, YS, Hascall, Vince C, Midura, Ron J, Cali, Valbona, Flask, Christopher A, Erokwu, Bernadette O, Martin, Richard J, MacFarlane, Peter M
Formato: Online Artículo Texto
Lenguaje:English
Publicado: 2022
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9079185/
https://www.ncbi.nlm.nih.gov/pubmed/34750521
http://dx.doi.org/10.1038/s41390-021-01695-0
_version_ 1784702507940839424
author Mayer, Catherine A
Ganguli, Abhrajit
Mayer, Aubrey
Pabelick, Christina M
Prakash, YS
Hascall, Vince C
Midura, Ron J
Cali, Valbona
Flask, Christopher A
Erokwu, Bernadette O
Martin, Richard J
MacFarlane, Peter M
author_facet Mayer, Catherine A
Ganguli, Abhrajit
Mayer, Aubrey
Pabelick, Christina M
Prakash, YS
Hascall, Vince C
Midura, Ron J
Cali, Valbona
Flask, Christopher A
Erokwu, Bernadette O
Martin, Richard J
MacFarlane, Peter M
author_sort Mayer, Catherine A
collection PubMed
description BACKGROUND: Continuous positive airway pressure (CPAP) is a primary mode of respiratory support for preterm infants. Animal studies have shown long-term detrimental effects on lung/airway development, particularly airway (AW) hyper-reactivity, as an unfortunate consequence of neonatal CPAP. Since the hyaluronan (HA) synthesizing enzyme hyaluronan synthase-3 (HAS3) is involved in various adult pulmonary disorders, the present study used a neonatal mouse model to investigate the role of HAS3 in CPAP-induced AW hyper-reactivity. METHODS: Male and female neonatal mice were fitted with a custom-made mask for delivery of daily CPAP 3 h/day for 7 days. At postnatal day 21 (two weeks after CPAP ended), airway (AW) hyper-reactivity and HAS3 expression were assessed with and without in vitro HAS3 siRNA treatment. RESULTS: MRIs of 3-day-old mice confirmed that CPAP increased lung volume with incrementing inflation pressures. CPAP increased AW reactivity in both male and female mice, which was associated with increased airway smooth muscle and epithelial HAS3 immunoreactivity. CPAP did not affect HA accumulation, but HAS3 siRNA reversed CPAP-induced AW hyper-reactivity and reduced HAS3 expression. CONCLUSIONS: These data in mice implicate a role for HAS3 in long-term effects of CPAP in the developing airway in the context of preterm birth and CPAP therapy.
format Online
Article
Text
id pubmed-9079185
institution National Center for Biotechnology Information
language English
publishDate 2022
record_format MEDLINE/PubMed
spelling pubmed-90791852022-10-18 CPAP-induced Airway Hyper-reactivity in Mice is Modulated by Hyaluronan Synthase-3 Mayer, Catherine A Ganguli, Abhrajit Mayer, Aubrey Pabelick, Christina M Prakash, YS Hascall, Vince C Midura, Ron J Cali, Valbona Flask, Christopher A Erokwu, Bernadette O Martin, Richard J MacFarlane, Peter M Pediatr Res Article BACKGROUND: Continuous positive airway pressure (CPAP) is a primary mode of respiratory support for preterm infants. Animal studies have shown long-term detrimental effects on lung/airway development, particularly airway (AW) hyper-reactivity, as an unfortunate consequence of neonatal CPAP. Since the hyaluronan (HA) synthesizing enzyme hyaluronan synthase-3 (HAS3) is involved in various adult pulmonary disorders, the present study used a neonatal mouse model to investigate the role of HAS3 in CPAP-induced AW hyper-reactivity. METHODS: Male and female neonatal mice were fitted with a custom-made mask for delivery of daily CPAP 3 h/day for 7 days. At postnatal day 21 (two weeks after CPAP ended), airway (AW) hyper-reactivity and HAS3 expression were assessed with and without in vitro HAS3 siRNA treatment. RESULTS: MRIs of 3-day-old mice confirmed that CPAP increased lung volume with incrementing inflation pressures. CPAP increased AW reactivity in both male and female mice, which was associated with increased airway smooth muscle and epithelial HAS3 immunoreactivity. CPAP did not affect HA accumulation, but HAS3 siRNA reversed CPAP-induced AW hyper-reactivity and reduced HAS3 expression. CONCLUSIONS: These data in mice implicate a role for HAS3 in long-term effects of CPAP in the developing airway in the context of preterm birth and CPAP therapy. 2022-09 2021-11-08 /pmc/articles/PMC9079185/ /pubmed/34750521 http://dx.doi.org/10.1038/s41390-021-01695-0 Text en http://www.nature.com/authors/editorial_policies/license.html#termsUsers may view, print, copy, and download text and data-mine the content in such documents, for the purposes of academic research, subject always to the full Conditions of use:http://www.nature.com/authors/editorial_policies/license.html#terms
spellingShingle Article
Mayer, Catherine A
Ganguli, Abhrajit
Mayer, Aubrey
Pabelick, Christina M
Prakash, YS
Hascall, Vince C
Midura, Ron J
Cali, Valbona
Flask, Christopher A
Erokwu, Bernadette O
Martin, Richard J
MacFarlane, Peter M
CPAP-induced Airway Hyper-reactivity in Mice is Modulated by Hyaluronan Synthase-3
title CPAP-induced Airway Hyper-reactivity in Mice is Modulated by Hyaluronan Synthase-3
title_full CPAP-induced Airway Hyper-reactivity in Mice is Modulated by Hyaluronan Synthase-3
title_fullStr CPAP-induced Airway Hyper-reactivity in Mice is Modulated by Hyaluronan Synthase-3
title_full_unstemmed CPAP-induced Airway Hyper-reactivity in Mice is Modulated by Hyaluronan Synthase-3
title_short CPAP-induced Airway Hyper-reactivity in Mice is Modulated by Hyaluronan Synthase-3
title_sort cpap-induced airway hyper-reactivity in mice is modulated by hyaluronan synthase-3
topic Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9079185/
https://www.ncbi.nlm.nih.gov/pubmed/34750521
http://dx.doi.org/10.1038/s41390-021-01695-0
work_keys_str_mv AT mayercatherinea cpapinducedairwayhyperreactivityinmiceismodulatedbyhyaluronansynthase3
AT ganguliabhrajit cpapinducedairwayhyperreactivityinmiceismodulatedbyhyaluronansynthase3
AT mayeraubrey cpapinducedairwayhyperreactivityinmiceismodulatedbyhyaluronansynthase3
AT pabelickchristinam cpapinducedairwayhyperreactivityinmiceismodulatedbyhyaluronansynthase3
AT prakashys cpapinducedairwayhyperreactivityinmiceismodulatedbyhyaluronansynthase3
AT hascallvincec cpapinducedairwayhyperreactivityinmiceismodulatedbyhyaluronansynthase3
AT miduraronj cpapinducedairwayhyperreactivityinmiceismodulatedbyhyaluronansynthase3
AT calivalbona cpapinducedairwayhyperreactivityinmiceismodulatedbyhyaluronansynthase3
AT flaskchristophera cpapinducedairwayhyperreactivityinmiceismodulatedbyhyaluronansynthase3
AT erokwubernadetteo cpapinducedairwayhyperreactivityinmiceismodulatedbyhyaluronansynthase3
AT martinrichardj cpapinducedairwayhyperreactivityinmiceismodulatedbyhyaluronansynthase3
AT macfarlanepeterm cpapinducedairwayhyperreactivityinmiceismodulatedbyhyaluronansynthase3