Cargando…
Upon heat stress processing of ribosomal RNA precursors into mature rRNAs is compromised after cleavage at primary P site in Arabidopsis thaliana
Transcription and processing of 45S rRNAs in the nucleolus are keystones of ribosome biogenesis. While these processes are severely impacted by stress conditions in multiple species, primarily upon heat exposure, we lack information about the molecular mechanisms allowing sessile organisms without a...
Autores principales: | , , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Taylor & Francis
2022
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9090299/ https://www.ncbi.nlm.nih.gov/pubmed/35522061 http://dx.doi.org/10.1080/15476286.2022.2071517 |
_version_ | 1784704693402861568 |
---|---|
author | Darriere, T. Jobet, E. Zavala, D. Escande, M.L. Durut, N. de Bures, A. Blanco-Herrera, F. Vidal, E.A. Rompais, M. Carapito, C. Gourbiere, S. Sáez-Vásquez, J. |
author_facet | Darriere, T. Jobet, E. Zavala, D. Escande, M.L. Durut, N. de Bures, A. Blanco-Herrera, F. Vidal, E.A. Rompais, M. Carapito, C. Gourbiere, S. Sáez-Vásquez, J. |
author_sort | Darriere, T. |
collection | PubMed |
description | Transcription and processing of 45S rRNAs in the nucleolus are keystones of ribosome biogenesis. While these processes are severely impacted by stress conditions in multiple species, primarily upon heat exposure, we lack information about the molecular mechanisms allowing sessile organisms without a temperature-control system, like plants, to cope with such circumstances. We show that heat stress disturbs nucleolar structure, inhibits pre-rRNA processing and provokes imbalanced ribosome profiles in Arabidopsis thaliana plants. Notably, the accuracy of transcription initiation and cleavage at the primary P site in the 5’ETS (5’ External Transcribed Spacer) are not affected but the levels of primary 45S and 35S transcripts are, respectively, increased and reduced. In contrast, precursors of 18S, 5.8S and 25S RNAs are rapidly undetectable upon heat stress. Remarkably, nucleolar structure, pre-rRNAs from major ITS1 processing pathway and ribosome profiles are restored after returning to optimal conditions, shedding light on the extreme plasticity of nucleolar functions in plant cells. Further genetic and molecular analysis to identify molecular clues implicated in these nucleolar responses indicate that cleavage rate at P site and nucleolin protein expression can act as a checkpoint control towards a productive pre-rRNA processing pathway. |
format | Online Article Text |
id | pubmed-9090299 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2022 |
publisher | Taylor & Francis |
record_format | MEDLINE/PubMed |
spelling | pubmed-90902992022-05-11 Upon heat stress processing of ribosomal RNA precursors into mature rRNAs is compromised after cleavage at primary P site in Arabidopsis thaliana Darriere, T. Jobet, E. Zavala, D. Escande, M.L. Durut, N. de Bures, A. Blanco-Herrera, F. Vidal, E.A. Rompais, M. Carapito, C. Gourbiere, S. Sáez-Vásquez, J. RNA Biol Research Paper Transcription and processing of 45S rRNAs in the nucleolus are keystones of ribosome biogenesis. While these processes are severely impacted by stress conditions in multiple species, primarily upon heat exposure, we lack information about the molecular mechanisms allowing sessile organisms without a temperature-control system, like plants, to cope with such circumstances. We show that heat stress disturbs nucleolar structure, inhibits pre-rRNA processing and provokes imbalanced ribosome profiles in Arabidopsis thaliana plants. Notably, the accuracy of transcription initiation and cleavage at the primary P site in the 5’ETS (5’ External Transcribed Spacer) are not affected but the levels of primary 45S and 35S transcripts are, respectively, increased and reduced. In contrast, precursors of 18S, 5.8S and 25S RNAs are rapidly undetectable upon heat stress. Remarkably, nucleolar structure, pre-rRNAs from major ITS1 processing pathway and ribosome profiles are restored after returning to optimal conditions, shedding light on the extreme plasticity of nucleolar functions in plant cells. Further genetic and molecular analysis to identify molecular clues implicated in these nucleolar responses indicate that cleavage rate at P site and nucleolin protein expression can act as a checkpoint control towards a productive pre-rRNA processing pathway. Taylor & Francis 2022-05-06 /pmc/articles/PMC9090299/ /pubmed/35522061 http://dx.doi.org/10.1080/15476286.2022.2071517 Text en © 2022 The Author(s). Published by Informa UK Limited, trading as Taylor & Francis Group. https://creativecommons.org/licenses/by/4.0/This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) ), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. |
spellingShingle | Research Paper Darriere, T. Jobet, E. Zavala, D. Escande, M.L. Durut, N. de Bures, A. Blanco-Herrera, F. Vidal, E.A. Rompais, M. Carapito, C. Gourbiere, S. Sáez-Vásquez, J. Upon heat stress processing of ribosomal RNA precursors into mature rRNAs is compromised after cleavage at primary P site in Arabidopsis thaliana |
title | Upon heat stress processing of ribosomal RNA precursors into mature rRNAs is compromised after cleavage at primary P site in Arabidopsis thaliana |
title_full | Upon heat stress processing of ribosomal RNA precursors into mature rRNAs is compromised after cleavage at primary P site in Arabidopsis thaliana |
title_fullStr | Upon heat stress processing of ribosomal RNA precursors into mature rRNAs is compromised after cleavage at primary P site in Arabidopsis thaliana |
title_full_unstemmed | Upon heat stress processing of ribosomal RNA precursors into mature rRNAs is compromised after cleavage at primary P site in Arabidopsis thaliana |
title_short | Upon heat stress processing of ribosomal RNA precursors into mature rRNAs is compromised after cleavage at primary P site in Arabidopsis thaliana |
title_sort | upon heat stress processing of ribosomal rna precursors into mature rrnas is compromised after cleavage at primary p site in arabidopsis thaliana |
topic | Research Paper |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9090299/ https://www.ncbi.nlm.nih.gov/pubmed/35522061 http://dx.doi.org/10.1080/15476286.2022.2071517 |
work_keys_str_mv | AT darrieret uponheatstressprocessingofribosomalrnaprecursorsintomaturerrnasiscompromisedaftercleavageatprimarypsiteinarabidopsisthaliana AT jobete uponheatstressprocessingofribosomalrnaprecursorsintomaturerrnasiscompromisedaftercleavageatprimarypsiteinarabidopsisthaliana AT zavalad uponheatstressprocessingofribosomalrnaprecursorsintomaturerrnasiscompromisedaftercleavageatprimarypsiteinarabidopsisthaliana AT escandeml uponheatstressprocessingofribosomalrnaprecursorsintomaturerrnasiscompromisedaftercleavageatprimarypsiteinarabidopsisthaliana AT durutn uponheatstressprocessingofribosomalrnaprecursorsintomaturerrnasiscompromisedaftercleavageatprimarypsiteinarabidopsisthaliana AT deburesa uponheatstressprocessingofribosomalrnaprecursorsintomaturerrnasiscompromisedaftercleavageatprimarypsiteinarabidopsisthaliana AT blancoherreraf uponheatstressprocessingofribosomalrnaprecursorsintomaturerrnasiscompromisedaftercleavageatprimarypsiteinarabidopsisthaliana AT vidalea uponheatstressprocessingofribosomalrnaprecursorsintomaturerrnasiscompromisedaftercleavageatprimarypsiteinarabidopsisthaliana AT rompaism uponheatstressprocessingofribosomalrnaprecursorsintomaturerrnasiscompromisedaftercleavageatprimarypsiteinarabidopsisthaliana AT carapitoc uponheatstressprocessingofribosomalrnaprecursorsintomaturerrnasiscompromisedaftercleavageatprimarypsiteinarabidopsisthaliana AT gourbieres uponheatstressprocessingofribosomalrnaprecursorsintomaturerrnasiscompromisedaftercleavageatprimarypsiteinarabidopsisthaliana AT saezvasquezj uponheatstressprocessingofribosomalrnaprecursorsintomaturerrnasiscompromisedaftercleavageatprimarypsiteinarabidopsisthaliana |