Cargando…

Upon heat stress processing of ribosomal RNA precursors into mature rRNAs is compromised after cleavage at primary P site in Arabidopsis thaliana

Transcription and processing of 45S rRNAs in the nucleolus are keystones of ribosome biogenesis. While these processes are severely impacted by stress conditions in multiple species, primarily upon heat exposure, we lack information about the molecular mechanisms allowing sessile organisms without a...

Descripción completa

Detalles Bibliográficos
Autores principales: Darriere, T., Jobet, E., Zavala, D., Escande, M.L., Durut, N., de Bures, A., Blanco-Herrera, F., Vidal, E.A., Rompais, M., Carapito, C., Gourbiere, S., Sáez-Vásquez, J.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Taylor & Francis 2022
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9090299/
https://www.ncbi.nlm.nih.gov/pubmed/35522061
http://dx.doi.org/10.1080/15476286.2022.2071517
_version_ 1784704693402861568
author Darriere, T.
Jobet, E.
Zavala, D.
Escande, M.L.
Durut, N.
de Bures, A.
Blanco-Herrera, F.
Vidal, E.A.
Rompais, M.
Carapito, C.
Gourbiere, S.
Sáez-Vásquez, J.
author_facet Darriere, T.
Jobet, E.
Zavala, D.
Escande, M.L.
Durut, N.
de Bures, A.
Blanco-Herrera, F.
Vidal, E.A.
Rompais, M.
Carapito, C.
Gourbiere, S.
Sáez-Vásquez, J.
author_sort Darriere, T.
collection PubMed
description Transcription and processing of 45S rRNAs in the nucleolus are keystones of ribosome biogenesis. While these processes are severely impacted by stress conditions in multiple species, primarily upon heat exposure, we lack information about the molecular mechanisms allowing sessile organisms without a temperature-control system, like plants, to cope with such circumstances. We show that heat stress disturbs nucleolar structure, inhibits pre-rRNA processing and provokes imbalanced ribosome profiles in Arabidopsis thaliana plants. Notably, the accuracy of transcription initiation and cleavage at the primary P site in the 5’ETS (5’ External Transcribed Spacer) are not affected but the levels of primary 45S and 35S transcripts are, respectively, increased and reduced. In contrast, precursors of 18S, 5.8S and 25S RNAs are rapidly undetectable upon heat stress. Remarkably, nucleolar structure, pre-rRNAs from major ITS1 processing pathway and ribosome profiles are restored after returning to optimal conditions, shedding light on the extreme plasticity of nucleolar functions in plant cells. Further genetic and molecular analysis to identify molecular clues implicated in these nucleolar responses indicate that cleavage rate at P site and nucleolin protein expression can act as a checkpoint control towards a productive pre-rRNA processing pathway.
format Online
Article
Text
id pubmed-9090299
institution National Center for Biotechnology Information
language English
publishDate 2022
publisher Taylor & Francis
record_format MEDLINE/PubMed
spelling pubmed-90902992022-05-11 Upon heat stress processing of ribosomal RNA precursors into mature rRNAs is compromised after cleavage at primary P site in Arabidopsis thaliana Darriere, T. Jobet, E. Zavala, D. Escande, M.L. Durut, N. de Bures, A. Blanco-Herrera, F. Vidal, E.A. Rompais, M. Carapito, C. Gourbiere, S. Sáez-Vásquez, J. RNA Biol Research Paper Transcription and processing of 45S rRNAs in the nucleolus are keystones of ribosome biogenesis. While these processes are severely impacted by stress conditions in multiple species, primarily upon heat exposure, we lack information about the molecular mechanisms allowing sessile organisms without a temperature-control system, like plants, to cope with such circumstances. We show that heat stress disturbs nucleolar structure, inhibits pre-rRNA processing and provokes imbalanced ribosome profiles in Arabidopsis thaliana plants. Notably, the accuracy of transcription initiation and cleavage at the primary P site in the 5’ETS (5’ External Transcribed Spacer) are not affected but the levels of primary 45S and 35S transcripts are, respectively, increased and reduced. In contrast, precursors of 18S, 5.8S and 25S RNAs are rapidly undetectable upon heat stress. Remarkably, nucleolar structure, pre-rRNAs from major ITS1 processing pathway and ribosome profiles are restored after returning to optimal conditions, shedding light on the extreme plasticity of nucleolar functions in plant cells. Further genetic and molecular analysis to identify molecular clues implicated in these nucleolar responses indicate that cleavage rate at P site and nucleolin protein expression can act as a checkpoint control towards a productive pre-rRNA processing pathway. Taylor & Francis 2022-05-06 /pmc/articles/PMC9090299/ /pubmed/35522061 http://dx.doi.org/10.1080/15476286.2022.2071517 Text en © 2022 The Author(s). Published by Informa UK Limited, trading as Taylor & Francis Group. https://creativecommons.org/licenses/by/4.0/This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) ), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited.
spellingShingle Research Paper
Darriere, T.
Jobet, E.
Zavala, D.
Escande, M.L.
Durut, N.
de Bures, A.
Blanco-Herrera, F.
Vidal, E.A.
Rompais, M.
Carapito, C.
Gourbiere, S.
Sáez-Vásquez, J.
Upon heat stress processing of ribosomal RNA precursors into mature rRNAs is compromised after cleavage at primary P site in Arabidopsis thaliana
title Upon heat stress processing of ribosomal RNA precursors into mature rRNAs is compromised after cleavage at primary P site in Arabidopsis thaliana
title_full Upon heat stress processing of ribosomal RNA precursors into mature rRNAs is compromised after cleavage at primary P site in Arabidopsis thaliana
title_fullStr Upon heat stress processing of ribosomal RNA precursors into mature rRNAs is compromised after cleavage at primary P site in Arabidopsis thaliana
title_full_unstemmed Upon heat stress processing of ribosomal RNA precursors into mature rRNAs is compromised after cleavage at primary P site in Arabidopsis thaliana
title_short Upon heat stress processing of ribosomal RNA precursors into mature rRNAs is compromised after cleavage at primary P site in Arabidopsis thaliana
title_sort upon heat stress processing of ribosomal rna precursors into mature rrnas is compromised after cleavage at primary p site in arabidopsis thaliana
topic Research Paper
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9090299/
https://www.ncbi.nlm.nih.gov/pubmed/35522061
http://dx.doi.org/10.1080/15476286.2022.2071517
work_keys_str_mv AT darrieret uponheatstressprocessingofribosomalrnaprecursorsintomaturerrnasiscompromisedaftercleavageatprimarypsiteinarabidopsisthaliana
AT jobete uponheatstressprocessingofribosomalrnaprecursorsintomaturerrnasiscompromisedaftercleavageatprimarypsiteinarabidopsisthaliana
AT zavalad uponheatstressprocessingofribosomalrnaprecursorsintomaturerrnasiscompromisedaftercleavageatprimarypsiteinarabidopsisthaliana
AT escandeml uponheatstressprocessingofribosomalrnaprecursorsintomaturerrnasiscompromisedaftercleavageatprimarypsiteinarabidopsisthaliana
AT durutn uponheatstressprocessingofribosomalrnaprecursorsintomaturerrnasiscompromisedaftercleavageatprimarypsiteinarabidopsisthaliana
AT deburesa uponheatstressprocessingofribosomalrnaprecursorsintomaturerrnasiscompromisedaftercleavageatprimarypsiteinarabidopsisthaliana
AT blancoherreraf uponheatstressprocessingofribosomalrnaprecursorsintomaturerrnasiscompromisedaftercleavageatprimarypsiteinarabidopsisthaliana
AT vidalea uponheatstressprocessingofribosomalrnaprecursorsintomaturerrnasiscompromisedaftercleavageatprimarypsiteinarabidopsisthaliana
AT rompaism uponheatstressprocessingofribosomalrnaprecursorsintomaturerrnasiscompromisedaftercleavageatprimarypsiteinarabidopsisthaliana
AT carapitoc uponheatstressprocessingofribosomalrnaprecursorsintomaturerrnasiscompromisedaftercleavageatprimarypsiteinarabidopsisthaliana
AT gourbieres uponheatstressprocessingofribosomalrnaprecursorsintomaturerrnasiscompromisedaftercleavageatprimarypsiteinarabidopsisthaliana
AT saezvasquezj uponheatstressprocessingofribosomalrnaprecursorsintomaturerrnasiscompromisedaftercleavageatprimarypsiteinarabidopsisthaliana