Cargando…
Risk assessment of urban yellow fever virus transmission in Kenya: is Aedes aegypti an efficient vector?
The absence of urban yellow fever epidemics in East Africa remains a mystery amidst the proliferation of Aedes aegypti in this region. To understand the transmission dynamics of the disease, we tested urban (Mombasa, Kisumu, and Nairobi) Aedes mosquito populations in Kenya for their susceptibility t...
Autores principales: | , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Taylor & Francis
2022
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9090368/ https://www.ncbi.nlm.nih.gov/pubmed/35387573 http://dx.doi.org/10.1080/22221751.2022.2063762 |
_version_ | 1784704709507940352 |
---|---|
author | Agha, Sheila B. Tchouassi, David P. Turell, Michael J. Bastos, Armanda D.S. Sang, Rosemary |
author_facet | Agha, Sheila B. Tchouassi, David P. Turell, Michael J. Bastos, Armanda D.S. Sang, Rosemary |
author_sort | Agha, Sheila B. |
collection | PubMed |
description | The absence of urban yellow fever epidemics in East Africa remains a mystery amidst the proliferation of Aedes aegypti in this region. To understand the transmission dynamics of the disease, we tested urban (Mombasa, Kisumu, and Nairobi) Aedes mosquito populations in Kenya for their susceptibility to an East African yellow fever virus (YFV) genotype. Overall, 22% (n = 805) of the Ae. aegypti that were orally challenged with an infectious dose of YFV had a midgut infection, with comparable rates for Mombasa and Kisumu (χ(2 )= 0.35, df = 1, P = 0.55), but significantly lower rates for Nairobi (χ(2) ≥ 11.08, df = 1, P ≤ 0.0009). Variations in YFV susceptibility (midgut infection) among Ae. aegypti subspecies were not associated with discernable cytochrome c oxidase subunit 1 gene haplotypes. Remarkably, no YFV dissemination or transmission was observed among the orally challenged Ae. aegypti populations. Moreover, Ae. aegypti mosquitoes that were intrathoracically inoculated with YFV failed to transmit the virus via capillary feeding. In contrast, dissemination (oral exposure) and transmission (intrathoracic inoculation) of YFV was observed among a few peri-domestic Ae. bromeliae mosquitoes (n = 129) that were assessed from these urban areas. Our study highlights an inefficient urban Ae. aegypti population, and the potential for Ae. bromeliae in sustaining an urban YFV transmission in Kenya. An assessment of urban Ae. aegypti susceptibility to other YFV genotypes, and vector potential of urban Ae. bromeliae populations in Kenya is recommended to guide cost-effective vaccination. |
format | Online Article Text |
id | pubmed-9090368 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2022 |
publisher | Taylor & Francis |
record_format | MEDLINE/PubMed |
spelling | pubmed-90903682022-05-11 Risk assessment of urban yellow fever virus transmission in Kenya: is Aedes aegypti an efficient vector? Agha, Sheila B. Tchouassi, David P. Turell, Michael J. Bastos, Armanda D.S. Sang, Rosemary Emerg Microbes Infect Research Article The absence of urban yellow fever epidemics in East Africa remains a mystery amidst the proliferation of Aedes aegypti in this region. To understand the transmission dynamics of the disease, we tested urban (Mombasa, Kisumu, and Nairobi) Aedes mosquito populations in Kenya for their susceptibility to an East African yellow fever virus (YFV) genotype. Overall, 22% (n = 805) of the Ae. aegypti that were orally challenged with an infectious dose of YFV had a midgut infection, with comparable rates for Mombasa and Kisumu (χ(2 )= 0.35, df = 1, P = 0.55), but significantly lower rates for Nairobi (χ(2) ≥ 11.08, df = 1, P ≤ 0.0009). Variations in YFV susceptibility (midgut infection) among Ae. aegypti subspecies were not associated with discernable cytochrome c oxidase subunit 1 gene haplotypes. Remarkably, no YFV dissemination or transmission was observed among the orally challenged Ae. aegypti populations. Moreover, Ae. aegypti mosquitoes that were intrathoracically inoculated with YFV failed to transmit the virus via capillary feeding. In contrast, dissemination (oral exposure) and transmission (intrathoracic inoculation) of YFV was observed among a few peri-domestic Ae. bromeliae mosquitoes (n = 129) that were assessed from these urban areas. Our study highlights an inefficient urban Ae. aegypti population, and the potential for Ae. bromeliae in sustaining an urban YFV transmission in Kenya. An assessment of urban Ae. aegypti susceptibility to other YFV genotypes, and vector potential of urban Ae. bromeliae populations in Kenya is recommended to guide cost-effective vaccination. Taylor & Francis 2022-05-05 /pmc/articles/PMC9090368/ /pubmed/35387573 http://dx.doi.org/10.1080/22221751.2022.2063762 Text en © 2022 The Author(s). Published by Informa UK Limited, trading as Taylor & Francis Group. https://creativecommons.org/licenses/by/4.0/This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) ), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. |
spellingShingle | Research Article Agha, Sheila B. Tchouassi, David P. Turell, Michael J. Bastos, Armanda D.S. Sang, Rosemary Risk assessment of urban yellow fever virus transmission in Kenya: is Aedes aegypti an efficient vector? |
title | Risk assessment of urban yellow fever virus transmission in Kenya: is Aedes aegypti an efficient vector? |
title_full | Risk assessment of urban yellow fever virus transmission in Kenya: is Aedes aegypti an efficient vector? |
title_fullStr | Risk assessment of urban yellow fever virus transmission in Kenya: is Aedes aegypti an efficient vector? |
title_full_unstemmed | Risk assessment of urban yellow fever virus transmission in Kenya: is Aedes aegypti an efficient vector? |
title_short | Risk assessment of urban yellow fever virus transmission in Kenya: is Aedes aegypti an efficient vector? |
title_sort | risk assessment of urban yellow fever virus transmission in kenya: is aedes aegypti an efficient vector? |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9090368/ https://www.ncbi.nlm.nih.gov/pubmed/35387573 http://dx.doi.org/10.1080/22221751.2022.2063762 |
work_keys_str_mv | AT aghasheilab riskassessmentofurbanyellowfevervirustransmissioninkenyaisaedesaegyptianefficientvector AT tchouassidavidp riskassessmentofurbanyellowfevervirustransmissioninkenyaisaedesaegyptianefficientvector AT turellmichaelj riskassessmentofurbanyellowfevervirustransmissioninkenyaisaedesaegyptianefficientvector AT bastosarmandads riskassessmentofurbanyellowfevervirustransmissioninkenyaisaedesaegyptianefficientvector AT sangrosemary riskassessmentofurbanyellowfevervirustransmissioninkenyaisaedesaegyptianefficientvector |