Cargando…
Impfstoffe gegen „coronavirus disease 2019“ (COVID-19): Wirksamkeitsvergleich, Sicherheitsaspekte und aktuelle Herausforderungen
Several RNA-, vector-, and protein-based coronavirus disease 2019 (COVID-19) vaccines are currently available in order to achieve high titers of neutralizing antibodies against the spike protein as well as strongly activated CD4+- and CD+ T‑cells. However, there are formulation-specific advantages a...
Autor principal: | |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Springer Medizin
2022
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9092324/ https://www.ncbi.nlm.nih.gov/pubmed/35543726 http://dx.doi.org/10.1007/s00108-022-01325-9 |
_version_ | 1784705116190801920 |
---|---|
author | Lipp, H. P. |
author_facet | Lipp, H. P. |
author_sort | Lipp, H. P. |
collection | PubMed |
description | Several RNA-, vector-, and protein-based coronavirus disease 2019 (COVID-19) vaccines are currently available in order to achieve high titers of neutralizing antibodies against the spike protein as well as strongly activated CD4+- and CD+ T‑cells. However, there are formulation-specific advantages and disadvantages with regard to physicochemical stability, spectrum of adverse effects, need for adjuvants or adaptability to potentially novel viral variants. Whereas children and pregnant women now have access to COVID-19 vaccines, it often remains difficult to achieve sufficient cellular and humoral immunity in heavily immunocompromised patients. As a consequence, innovative vaccines need to be developed for these patients. Undoubtedly, reports addressing, e.g. vaccine-associated myocarditis or thrombotic thrombocytopenia have led to uncertainties; however, vaccination remains the most important cornerstone in containing the pandemic. |
format | Online Article Text |
id | pubmed-9092324 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2022 |
publisher | Springer Medizin |
record_format | MEDLINE/PubMed |
spelling | pubmed-90923242022-05-11 Impfstoffe gegen „coronavirus disease 2019“ (COVID-19): Wirksamkeitsvergleich, Sicherheitsaspekte und aktuelle Herausforderungen Lipp, H. P. Inn Med (Heidelb) Arzneimitteltherapie Several RNA-, vector-, and protein-based coronavirus disease 2019 (COVID-19) vaccines are currently available in order to achieve high titers of neutralizing antibodies against the spike protein as well as strongly activated CD4+- and CD+ T‑cells. However, there are formulation-specific advantages and disadvantages with regard to physicochemical stability, spectrum of adverse effects, need for adjuvants or adaptability to potentially novel viral variants. Whereas children and pregnant women now have access to COVID-19 vaccines, it often remains difficult to achieve sufficient cellular and humoral immunity in heavily immunocompromised patients. As a consequence, innovative vaccines need to be developed for these patients. Undoubtedly, reports addressing, e.g. vaccine-associated myocarditis or thrombotic thrombocytopenia have led to uncertainties; however, vaccination remains the most important cornerstone in containing the pandemic. Springer Medizin 2022-05-11 2022 /pmc/articles/PMC9092324/ /pubmed/35543726 http://dx.doi.org/10.1007/s00108-022-01325-9 Text en © The Author(s), under exclusive licence to Springer Medizin Verlag GmbH, ein Teil von Springer Nature 2022 This article is made available via the PMC Open Access Subset for unrestricted research re-use and secondary analysis in any form or by any means with acknowledgement of the original source. These permissions are granted for the duration of the World Health Organization (WHO) declaration of COVID-19 as a global pandemic. |
spellingShingle | Arzneimitteltherapie Lipp, H. P. Impfstoffe gegen „coronavirus disease 2019“ (COVID-19): Wirksamkeitsvergleich, Sicherheitsaspekte und aktuelle Herausforderungen |
title | Impfstoffe gegen „coronavirus disease 2019“ (COVID-19): Wirksamkeitsvergleich, Sicherheitsaspekte und aktuelle Herausforderungen |
title_full | Impfstoffe gegen „coronavirus disease 2019“ (COVID-19): Wirksamkeitsvergleich, Sicherheitsaspekte und aktuelle Herausforderungen |
title_fullStr | Impfstoffe gegen „coronavirus disease 2019“ (COVID-19): Wirksamkeitsvergleich, Sicherheitsaspekte und aktuelle Herausforderungen |
title_full_unstemmed | Impfstoffe gegen „coronavirus disease 2019“ (COVID-19): Wirksamkeitsvergleich, Sicherheitsaspekte und aktuelle Herausforderungen |
title_short | Impfstoffe gegen „coronavirus disease 2019“ (COVID-19): Wirksamkeitsvergleich, Sicherheitsaspekte und aktuelle Herausforderungen |
title_sort | impfstoffe gegen „coronavirus disease 2019“ (covid-19): wirksamkeitsvergleich, sicherheitsaspekte und aktuelle herausforderungen |
topic | Arzneimitteltherapie |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9092324/ https://www.ncbi.nlm.nih.gov/pubmed/35543726 http://dx.doi.org/10.1007/s00108-022-01325-9 |
work_keys_str_mv | AT lipphp impfstoffegegencoronavirusdisease2019covid19wirksamkeitsvergleichsicherheitsaspekteundaktuelleherausforderungen |