Cargando…
Tumor necrosis factor‐alpha stimulated gene‐6: A biomarker reflecting disease activity in rheumatoid arthritis
BACKGROUND: To explore the serum tumor necrosis factor‐alpha stimulated gene‐6 (TSG‐6) level and its association with disease activity in rheumatoid arthritis (RA) patients. METHODS: We recruited 176 RA patients, 178 non‐RA patients (lupus erythematosus, osteoarthritis, ulcerative colitis, ankylosin...
Autores principales: | , , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
John Wiley and Sons Inc.
2022
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9102767/ https://www.ncbi.nlm.nih.gov/pubmed/35353944 http://dx.doi.org/10.1002/jcla.24395 |
_version_ | 1784707405527908352 |
---|---|
author | Hu, Tingting Liu, Yuhan Li, Xu Li, Xiaohang Liu, Yanzhao Wang, Qunxia Huang, Jiayi Yu, Jianlin Wu, Yang Chen, Simei Zeng, Tingting Tan, Liming |
author_facet | Hu, Tingting Liu, Yuhan Li, Xu Li, Xiaohang Liu, Yanzhao Wang, Qunxia Huang, Jiayi Yu, Jianlin Wu, Yang Chen, Simei Zeng, Tingting Tan, Liming |
author_sort | Hu, Tingting |
collection | PubMed |
description | BACKGROUND: To explore the serum tumor necrosis factor‐alpha stimulated gene‐6 (TSG‐6) level and its association with disease activity in rheumatoid arthritis (RA) patients. METHODS: We recruited 176 RA patients, 178 non‐RA patients (lupus erythematosus, osteoarthritis, ulcerative colitis, ankylosing spondylitis and psoriasis) and 71 healthy subjects. Serum TSG‐6 levels were detected by enzyme‐linked immunosorbent assay (ELISA). RA patients were divided into inactive RA and active RA groups by disease activity score of 28 joints based on C‐reactive protein (DAS28‐CRP). The receiver operating characteristic (ROC) curve and Spearman's rank correlation test analyzed the correlation between TSG‐6 concentration and RA disease activity. RESULTS: Tumor necrosis factor‐alpha stimulated gene‐6 levels in the RA group were increased (p < 0.01). TSG‐6 concentrations indicated an upward tendency with increased disease activity; The area under the curve (AUC) of TSG‐6 for diagnosing RA and assessing the severity of RA were 0.78 and 0.80, respectively; The combination of TSG‐6 and anti‐mutated citrullinated vimentin antibodies (anti‐MCV) (sensitivity:98.4%)improved the diagnostic accuracy of RA. Binary logistic regression analysis showed that TSG‐6 was an independent risk factor related to the severity of RA, and OR (95% CI) was 1.2 (1.003–1.453). CONCLUSION: The TSG‐6 levels in RA patients were elevated and related to disease activity. Therefore, TSG‐6 may serve as a new potential biomarker for evaluating RA disease activity. |
format | Online Article Text |
id | pubmed-9102767 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2022 |
publisher | John Wiley and Sons Inc. |
record_format | MEDLINE/PubMed |
spelling | pubmed-91027672022-05-18 Tumor necrosis factor‐alpha stimulated gene‐6: A biomarker reflecting disease activity in rheumatoid arthritis Hu, Tingting Liu, Yuhan Li, Xu Li, Xiaohang Liu, Yanzhao Wang, Qunxia Huang, Jiayi Yu, Jianlin Wu, Yang Chen, Simei Zeng, Tingting Tan, Liming J Clin Lab Anal Research Articles BACKGROUND: To explore the serum tumor necrosis factor‐alpha stimulated gene‐6 (TSG‐6) level and its association with disease activity in rheumatoid arthritis (RA) patients. METHODS: We recruited 176 RA patients, 178 non‐RA patients (lupus erythematosus, osteoarthritis, ulcerative colitis, ankylosing spondylitis and psoriasis) and 71 healthy subjects. Serum TSG‐6 levels were detected by enzyme‐linked immunosorbent assay (ELISA). RA patients were divided into inactive RA and active RA groups by disease activity score of 28 joints based on C‐reactive protein (DAS28‐CRP). The receiver operating characteristic (ROC) curve and Spearman's rank correlation test analyzed the correlation between TSG‐6 concentration and RA disease activity. RESULTS: Tumor necrosis factor‐alpha stimulated gene‐6 levels in the RA group were increased (p < 0.01). TSG‐6 concentrations indicated an upward tendency with increased disease activity; The area under the curve (AUC) of TSG‐6 for diagnosing RA and assessing the severity of RA were 0.78 and 0.80, respectively; The combination of TSG‐6 and anti‐mutated citrullinated vimentin antibodies (anti‐MCV) (sensitivity:98.4%)improved the diagnostic accuracy of RA. Binary logistic regression analysis showed that TSG‐6 was an independent risk factor related to the severity of RA, and OR (95% CI) was 1.2 (1.003–1.453). CONCLUSION: The TSG‐6 levels in RA patients were elevated and related to disease activity. Therefore, TSG‐6 may serve as a new potential biomarker for evaluating RA disease activity. John Wiley and Sons Inc. 2022-03-30 /pmc/articles/PMC9102767/ /pubmed/35353944 http://dx.doi.org/10.1002/jcla.24395 Text en © 2022 The Authors. Journal of Clinical Laboratory Analysis published by Wiley Periodicals LLC. https://creativecommons.org/licenses/by-nc-nd/4.0/This is an open access article under the terms of the http://creativecommons.org/licenses/by-nc-nd/4.0/ (https://creativecommons.org/licenses/by-nc-nd/4.0/) License, which permits use and distribution in any medium, provided the original work is properly cited, the use is non‐commercial and no modifications or adaptations are made. |
spellingShingle | Research Articles Hu, Tingting Liu, Yuhan Li, Xu Li, Xiaohang Liu, Yanzhao Wang, Qunxia Huang, Jiayi Yu, Jianlin Wu, Yang Chen, Simei Zeng, Tingting Tan, Liming Tumor necrosis factor‐alpha stimulated gene‐6: A biomarker reflecting disease activity in rheumatoid arthritis |
title | Tumor necrosis factor‐alpha stimulated gene‐6: A biomarker reflecting disease activity in rheumatoid arthritis |
title_full | Tumor necrosis factor‐alpha stimulated gene‐6: A biomarker reflecting disease activity in rheumatoid arthritis |
title_fullStr | Tumor necrosis factor‐alpha stimulated gene‐6: A biomarker reflecting disease activity in rheumatoid arthritis |
title_full_unstemmed | Tumor necrosis factor‐alpha stimulated gene‐6: A biomarker reflecting disease activity in rheumatoid arthritis |
title_short | Tumor necrosis factor‐alpha stimulated gene‐6: A biomarker reflecting disease activity in rheumatoid arthritis |
title_sort | tumor necrosis factor‐alpha stimulated gene‐6: a biomarker reflecting disease activity in rheumatoid arthritis |
topic | Research Articles |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9102767/ https://www.ncbi.nlm.nih.gov/pubmed/35353944 http://dx.doi.org/10.1002/jcla.24395 |
work_keys_str_mv | AT hutingting tumornecrosisfactoralphastimulatedgene6abiomarkerreflectingdiseaseactivityinrheumatoidarthritis AT liuyuhan tumornecrosisfactoralphastimulatedgene6abiomarkerreflectingdiseaseactivityinrheumatoidarthritis AT lixu tumornecrosisfactoralphastimulatedgene6abiomarkerreflectingdiseaseactivityinrheumatoidarthritis AT lixiaohang tumornecrosisfactoralphastimulatedgene6abiomarkerreflectingdiseaseactivityinrheumatoidarthritis AT liuyanzhao tumornecrosisfactoralphastimulatedgene6abiomarkerreflectingdiseaseactivityinrheumatoidarthritis AT wangqunxia tumornecrosisfactoralphastimulatedgene6abiomarkerreflectingdiseaseactivityinrheumatoidarthritis AT huangjiayi tumornecrosisfactoralphastimulatedgene6abiomarkerreflectingdiseaseactivityinrheumatoidarthritis AT yujianlin tumornecrosisfactoralphastimulatedgene6abiomarkerreflectingdiseaseactivityinrheumatoidarthritis AT wuyang tumornecrosisfactoralphastimulatedgene6abiomarkerreflectingdiseaseactivityinrheumatoidarthritis AT chensimei tumornecrosisfactoralphastimulatedgene6abiomarkerreflectingdiseaseactivityinrheumatoidarthritis AT zengtingting tumornecrosisfactoralphastimulatedgene6abiomarkerreflectingdiseaseactivityinrheumatoidarthritis AT tanliming tumornecrosisfactoralphastimulatedgene6abiomarkerreflectingdiseaseactivityinrheumatoidarthritis |