Cargando…

Tumor necrosis factor‐alpha stimulated gene‐6: A biomarker reflecting disease activity in rheumatoid arthritis

BACKGROUND: To explore the serum tumor necrosis factor‐alpha stimulated gene‐6 (TSG‐6) level and its association with disease activity in rheumatoid arthritis (RA) patients. METHODS: We recruited 176 RA patients, 178 non‐RA patients (lupus erythematosus, osteoarthritis, ulcerative colitis, ankylosin...

Descripción completa

Detalles Bibliográficos
Autores principales: Hu, Tingting, Liu, Yuhan, Li, Xu, Li, Xiaohang, Liu, Yanzhao, Wang, Qunxia, Huang, Jiayi, Yu, Jianlin, Wu, Yang, Chen, Simei, Zeng, Tingting, Tan, Liming
Formato: Online Artículo Texto
Lenguaje:English
Publicado: John Wiley and Sons Inc. 2022
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9102767/
https://www.ncbi.nlm.nih.gov/pubmed/35353944
http://dx.doi.org/10.1002/jcla.24395
_version_ 1784707405527908352
author Hu, Tingting
Liu, Yuhan
Li, Xu
Li, Xiaohang
Liu, Yanzhao
Wang, Qunxia
Huang, Jiayi
Yu, Jianlin
Wu, Yang
Chen, Simei
Zeng, Tingting
Tan, Liming
author_facet Hu, Tingting
Liu, Yuhan
Li, Xu
Li, Xiaohang
Liu, Yanzhao
Wang, Qunxia
Huang, Jiayi
Yu, Jianlin
Wu, Yang
Chen, Simei
Zeng, Tingting
Tan, Liming
author_sort Hu, Tingting
collection PubMed
description BACKGROUND: To explore the serum tumor necrosis factor‐alpha stimulated gene‐6 (TSG‐6) level and its association with disease activity in rheumatoid arthritis (RA) patients. METHODS: We recruited 176 RA patients, 178 non‐RA patients (lupus erythematosus, osteoarthritis, ulcerative colitis, ankylosing spondylitis and psoriasis) and 71 healthy subjects. Serum TSG‐6 levels were detected by enzyme‐linked immunosorbent assay (ELISA). RA patients were divided into inactive RA and active RA groups by disease activity score of 28 joints based on C‐reactive protein (DAS28‐CRP). The receiver operating characteristic (ROC) curve and Spearman's rank correlation test analyzed the correlation between TSG‐6 concentration and RA disease activity. RESULTS: Tumor necrosis factor‐alpha stimulated gene‐6 levels in the RA group were increased (p < 0.01). TSG‐6 concentrations indicated an upward tendency with increased disease activity; The area under the curve (AUC) of TSG‐6 for diagnosing RA and assessing the severity of RA were 0.78 and 0.80, respectively; The combination of TSG‐6 and anti‐mutated citrullinated vimentin antibodies (anti‐MCV) (sensitivity:98.4%)improved the diagnostic accuracy of RA. Binary logistic regression analysis showed that TSG‐6 was an independent risk factor related to the severity of RA, and OR (95% CI) was 1.2 (1.003–1.453). CONCLUSION: The TSG‐6 levels in RA patients were elevated and related to disease activity. Therefore, TSG‐6 may serve as a new potential biomarker for evaluating RA disease activity.
format Online
Article
Text
id pubmed-9102767
institution National Center for Biotechnology Information
language English
publishDate 2022
publisher John Wiley and Sons Inc.
record_format MEDLINE/PubMed
spelling pubmed-91027672022-05-18 Tumor necrosis factor‐alpha stimulated gene‐6: A biomarker reflecting disease activity in rheumatoid arthritis Hu, Tingting Liu, Yuhan Li, Xu Li, Xiaohang Liu, Yanzhao Wang, Qunxia Huang, Jiayi Yu, Jianlin Wu, Yang Chen, Simei Zeng, Tingting Tan, Liming J Clin Lab Anal Research Articles BACKGROUND: To explore the serum tumor necrosis factor‐alpha stimulated gene‐6 (TSG‐6) level and its association with disease activity in rheumatoid arthritis (RA) patients. METHODS: We recruited 176 RA patients, 178 non‐RA patients (lupus erythematosus, osteoarthritis, ulcerative colitis, ankylosing spondylitis and psoriasis) and 71 healthy subjects. Serum TSG‐6 levels were detected by enzyme‐linked immunosorbent assay (ELISA). RA patients were divided into inactive RA and active RA groups by disease activity score of 28 joints based on C‐reactive protein (DAS28‐CRP). The receiver operating characteristic (ROC) curve and Spearman's rank correlation test analyzed the correlation between TSG‐6 concentration and RA disease activity. RESULTS: Tumor necrosis factor‐alpha stimulated gene‐6 levels in the RA group were increased (p < 0.01). TSG‐6 concentrations indicated an upward tendency with increased disease activity; The area under the curve (AUC) of TSG‐6 for diagnosing RA and assessing the severity of RA were 0.78 and 0.80, respectively; The combination of TSG‐6 and anti‐mutated citrullinated vimentin antibodies (anti‐MCV) (sensitivity:98.4%)improved the diagnostic accuracy of RA. Binary logistic regression analysis showed that TSG‐6 was an independent risk factor related to the severity of RA, and OR (95% CI) was 1.2 (1.003–1.453). CONCLUSION: The TSG‐6 levels in RA patients were elevated and related to disease activity. Therefore, TSG‐6 may serve as a new potential biomarker for evaluating RA disease activity. John Wiley and Sons Inc. 2022-03-30 /pmc/articles/PMC9102767/ /pubmed/35353944 http://dx.doi.org/10.1002/jcla.24395 Text en © 2022 The Authors. Journal of Clinical Laboratory Analysis published by Wiley Periodicals LLC. https://creativecommons.org/licenses/by-nc-nd/4.0/This is an open access article under the terms of the http://creativecommons.org/licenses/by-nc-nd/4.0/ (https://creativecommons.org/licenses/by-nc-nd/4.0/) License, which permits use and distribution in any medium, provided the original work is properly cited, the use is non‐commercial and no modifications or adaptations are made.
spellingShingle Research Articles
Hu, Tingting
Liu, Yuhan
Li, Xu
Li, Xiaohang
Liu, Yanzhao
Wang, Qunxia
Huang, Jiayi
Yu, Jianlin
Wu, Yang
Chen, Simei
Zeng, Tingting
Tan, Liming
Tumor necrosis factor‐alpha stimulated gene‐6: A biomarker reflecting disease activity in rheumatoid arthritis
title Tumor necrosis factor‐alpha stimulated gene‐6: A biomarker reflecting disease activity in rheumatoid arthritis
title_full Tumor necrosis factor‐alpha stimulated gene‐6: A biomarker reflecting disease activity in rheumatoid arthritis
title_fullStr Tumor necrosis factor‐alpha stimulated gene‐6: A biomarker reflecting disease activity in rheumatoid arthritis
title_full_unstemmed Tumor necrosis factor‐alpha stimulated gene‐6: A biomarker reflecting disease activity in rheumatoid arthritis
title_short Tumor necrosis factor‐alpha stimulated gene‐6: A biomarker reflecting disease activity in rheumatoid arthritis
title_sort tumor necrosis factor‐alpha stimulated gene‐6: a biomarker reflecting disease activity in rheumatoid arthritis
topic Research Articles
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9102767/
https://www.ncbi.nlm.nih.gov/pubmed/35353944
http://dx.doi.org/10.1002/jcla.24395
work_keys_str_mv AT hutingting tumornecrosisfactoralphastimulatedgene6abiomarkerreflectingdiseaseactivityinrheumatoidarthritis
AT liuyuhan tumornecrosisfactoralphastimulatedgene6abiomarkerreflectingdiseaseactivityinrheumatoidarthritis
AT lixu tumornecrosisfactoralphastimulatedgene6abiomarkerreflectingdiseaseactivityinrheumatoidarthritis
AT lixiaohang tumornecrosisfactoralphastimulatedgene6abiomarkerreflectingdiseaseactivityinrheumatoidarthritis
AT liuyanzhao tumornecrosisfactoralphastimulatedgene6abiomarkerreflectingdiseaseactivityinrheumatoidarthritis
AT wangqunxia tumornecrosisfactoralphastimulatedgene6abiomarkerreflectingdiseaseactivityinrheumatoidarthritis
AT huangjiayi tumornecrosisfactoralphastimulatedgene6abiomarkerreflectingdiseaseactivityinrheumatoidarthritis
AT yujianlin tumornecrosisfactoralphastimulatedgene6abiomarkerreflectingdiseaseactivityinrheumatoidarthritis
AT wuyang tumornecrosisfactoralphastimulatedgene6abiomarkerreflectingdiseaseactivityinrheumatoidarthritis
AT chensimei tumornecrosisfactoralphastimulatedgene6abiomarkerreflectingdiseaseactivityinrheumatoidarthritis
AT zengtingting tumornecrosisfactoralphastimulatedgene6abiomarkerreflectingdiseaseactivityinrheumatoidarthritis
AT tanliming tumornecrosisfactoralphastimulatedgene6abiomarkerreflectingdiseaseactivityinrheumatoidarthritis