Cargando…
Metalloendopeptidase ADAM-like Decysin 1 (ADAMDEC1) in Colonic Subepithelial PDGFRα(+) Cells Is a New Marker for Inflammatory Bowel Disease
Metalloendopeptidase ADAM-Like Decysin 1 (ADAMDEC1) is an anti-inflammatory peptidase that is almost exclusively expressed in the gastrointestinal (GI) tract. We have recently found abundant and selective expression of Adamdec1 in colonic mucosal PDGFRα(+) cells. However, the cellular origin for thi...
Autores principales: | , , , , , , , , , , , , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
MDPI
2022
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9103908/ https://www.ncbi.nlm.nih.gov/pubmed/35563399 http://dx.doi.org/10.3390/ijms23095007 |
_version_ | 1784707664996990976 |
---|---|
author | Ha, Se Eun Jorgensen, Brian G. Wei, Lai Jin, Byungchang Kim, Min-Seob Poudrier, Sandra M. Singh, Rajan Bartlett, Allison Zogg, Hannah Kim, Sei Baek, Gain Kurahashi, Masaaki Lee, Moon-Young Kim, Yong-Sung Choi, Suck-Chei Sasse, Kent C. Rubin, Samuel J. S. Gottfried-Blackmore, Andres Becker, Laren Habtezion, Aida Sanders, Kenton M. Ro, Seungil |
author_facet | Ha, Se Eun Jorgensen, Brian G. Wei, Lai Jin, Byungchang Kim, Min-Seob Poudrier, Sandra M. Singh, Rajan Bartlett, Allison Zogg, Hannah Kim, Sei Baek, Gain Kurahashi, Masaaki Lee, Moon-Young Kim, Yong-Sung Choi, Suck-Chei Sasse, Kent C. Rubin, Samuel J. S. Gottfried-Blackmore, Andres Becker, Laren Habtezion, Aida Sanders, Kenton M. Ro, Seungil |
author_sort | Ha, Se Eun |
collection | PubMed |
description | Metalloendopeptidase ADAM-Like Decysin 1 (ADAMDEC1) is an anti-inflammatory peptidase that is almost exclusively expressed in the gastrointestinal (GI) tract. We have recently found abundant and selective expression of Adamdec1 in colonic mucosal PDGFRα(+) cells. However, the cellular origin for this gene expression is controversial as it is also known to be expressed in intestinal macrophages. We found that Adamdec1 mRNAs were selectively expressed in colonic mucosal subepithelial PDGFRα(+) cells. ADAMDEC1 protein was mainly released from PDGFRα(+) cells and accumulated in the mucosal layer lamina propria space near the epithelial basement membrane. PDGFRα(+) cells significantly overexpressed Adamdec1 mRNAs and protein in DSS-induced colitis mice. Adamdec1 was predominantly expressed in CD45(−) PDGFRα(+) cells in DSS-induced colitis mice, with only minimal expression in CD45(+) CD64(+) macrophages. Additionally, overexpression of both ADAMDEC1 mRNA and protein was consistently observed in PDGFRα(+) cells, but not in CD64(+) macrophages found in human colonic mucosal tissue affected by Crohn’s disease. In summary, PDGFRα(+) cells selectively express ADAMDEC1, which is localized to the colon mucosa layer. ADAMDEC1 expression significantly increases in DSS-induced colitis affected mice and Crohn’s disease affected human tissue, suggesting that this gene can serve as a diagnostic and/or therapeutic target for intestinal inflammation and Crohn’s disease. |
format | Online Article Text |
id | pubmed-9103908 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2022 |
publisher | MDPI |
record_format | MEDLINE/PubMed |
spelling | pubmed-91039082022-05-14 Metalloendopeptidase ADAM-like Decysin 1 (ADAMDEC1) in Colonic Subepithelial PDGFRα(+) Cells Is a New Marker for Inflammatory Bowel Disease Ha, Se Eun Jorgensen, Brian G. Wei, Lai Jin, Byungchang Kim, Min-Seob Poudrier, Sandra M. Singh, Rajan Bartlett, Allison Zogg, Hannah Kim, Sei Baek, Gain Kurahashi, Masaaki Lee, Moon-Young Kim, Yong-Sung Choi, Suck-Chei Sasse, Kent C. Rubin, Samuel J. S. Gottfried-Blackmore, Andres Becker, Laren Habtezion, Aida Sanders, Kenton M. Ro, Seungil Int J Mol Sci Article Metalloendopeptidase ADAM-Like Decysin 1 (ADAMDEC1) is an anti-inflammatory peptidase that is almost exclusively expressed in the gastrointestinal (GI) tract. We have recently found abundant and selective expression of Adamdec1 in colonic mucosal PDGFRα(+) cells. However, the cellular origin for this gene expression is controversial as it is also known to be expressed in intestinal macrophages. We found that Adamdec1 mRNAs were selectively expressed in colonic mucosal subepithelial PDGFRα(+) cells. ADAMDEC1 protein was mainly released from PDGFRα(+) cells and accumulated in the mucosal layer lamina propria space near the epithelial basement membrane. PDGFRα(+) cells significantly overexpressed Adamdec1 mRNAs and protein in DSS-induced colitis mice. Adamdec1 was predominantly expressed in CD45(−) PDGFRα(+) cells in DSS-induced colitis mice, with only minimal expression in CD45(+) CD64(+) macrophages. Additionally, overexpression of both ADAMDEC1 mRNA and protein was consistently observed in PDGFRα(+) cells, but not in CD64(+) macrophages found in human colonic mucosal tissue affected by Crohn’s disease. In summary, PDGFRα(+) cells selectively express ADAMDEC1, which is localized to the colon mucosa layer. ADAMDEC1 expression significantly increases in DSS-induced colitis affected mice and Crohn’s disease affected human tissue, suggesting that this gene can serve as a diagnostic and/or therapeutic target for intestinal inflammation and Crohn’s disease. MDPI 2022-04-30 /pmc/articles/PMC9103908/ /pubmed/35563399 http://dx.doi.org/10.3390/ijms23095007 Text en © 2022 by the authors. https://creativecommons.org/licenses/by/4.0/Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/). |
spellingShingle | Article Ha, Se Eun Jorgensen, Brian G. Wei, Lai Jin, Byungchang Kim, Min-Seob Poudrier, Sandra M. Singh, Rajan Bartlett, Allison Zogg, Hannah Kim, Sei Baek, Gain Kurahashi, Masaaki Lee, Moon-Young Kim, Yong-Sung Choi, Suck-Chei Sasse, Kent C. Rubin, Samuel J. S. Gottfried-Blackmore, Andres Becker, Laren Habtezion, Aida Sanders, Kenton M. Ro, Seungil Metalloendopeptidase ADAM-like Decysin 1 (ADAMDEC1) in Colonic Subepithelial PDGFRα(+) Cells Is a New Marker for Inflammatory Bowel Disease |
title | Metalloendopeptidase ADAM-like Decysin 1 (ADAMDEC1) in Colonic Subepithelial PDGFRα(+) Cells Is a New Marker for Inflammatory Bowel Disease |
title_full | Metalloendopeptidase ADAM-like Decysin 1 (ADAMDEC1) in Colonic Subepithelial PDGFRα(+) Cells Is a New Marker for Inflammatory Bowel Disease |
title_fullStr | Metalloendopeptidase ADAM-like Decysin 1 (ADAMDEC1) in Colonic Subepithelial PDGFRα(+) Cells Is a New Marker for Inflammatory Bowel Disease |
title_full_unstemmed | Metalloendopeptidase ADAM-like Decysin 1 (ADAMDEC1) in Colonic Subepithelial PDGFRα(+) Cells Is a New Marker for Inflammatory Bowel Disease |
title_short | Metalloendopeptidase ADAM-like Decysin 1 (ADAMDEC1) in Colonic Subepithelial PDGFRα(+) Cells Is a New Marker for Inflammatory Bowel Disease |
title_sort | metalloendopeptidase adam-like decysin 1 (adamdec1) in colonic subepithelial pdgfrα(+) cells is a new marker for inflammatory bowel disease |
topic | Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9103908/ https://www.ncbi.nlm.nih.gov/pubmed/35563399 http://dx.doi.org/10.3390/ijms23095007 |
work_keys_str_mv | AT haseeun metalloendopeptidaseadamlikedecysin1adamdec1incolonicsubepithelialpdgfracellsisanewmarkerforinflammatoryboweldisease AT jorgensenbriang metalloendopeptidaseadamlikedecysin1adamdec1incolonicsubepithelialpdgfracellsisanewmarkerforinflammatoryboweldisease AT weilai metalloendopeptidaseadamlikedecysin1adamdec1incolonicsubepithelialpdgfracellsisanewmarkerforinflammatoryboweldisease AT jinbyungchang metalloendopeptidaseadamlikedecysin1adamdec1incolonicsubepithelialpdgfracellsisanewmarkerforinflammatoryboweldisease AT kimminseob metalloendopeptidaseadamlikedecysin1adamdec1incolonicsubepithelialpdgfracellsisanewmarkerforinflammatoryboweldisease AT poudriersandram metalloendopeptidaseadamlikedecysin1adamdec1incolonicsubepithelialpdgfracellsisanewmarkerforinflammatoryboweldisease AT singhrajan metalloendopeptidaseadamlikedecysin1adamdec1incolonicsubepithelialpdgfracellsisanewmarkerforinflammatoryboweldisease AT bartlettallison metalloendopeptidaseadamlikedecysin1adamdec1incolonicsubepithelialpdgfracellsisanewmarkerforinflammatoryboweldisease AT zogghannah metalloendopeptidaseadamlikedecysin1adamdec1incolonicsubepithelialpdgfracellsisanewmarkerforinflammatoryboweldisease AT kimsei metalloendopeptidaseadamlikedecysin1adamdec1incolonicsubepithelialpdgfracellsisanewmarkerforinflammatoryboweldisease AT baekgain metalloendopeptidaseadamlikedecysin1adamdec1incolonicsubepithelialpdgfracellsisanewmarkerforinflammatoryboweldisease AT kurahashimasaaki metalloendopeptidaseadamlikedecysin1adamdec1incolonicsubepithelialpdgfracellsisanewmarkerforinflammatoryboweldisease AT leemoonyoung metalloendopeptidaseadamlikedecysin1adamdec1incolonicsubepithelialpdgfracellsisanewmarkerforinflammatoryboweldisease AT kimyongsung metalloendopeptidaseadamlikedecysin1adamdec1incolonicsubepithelialpdgfracellsisanewmarkerforinflammatoryboweldisease AT choisuckchei metalloendopeptidaseadamlikedecysin1adamdec1incolonicsubepithelialpdgfracellsisanewmarkerforinflammatoryboweldisease AT sassekentc metalloendopeptidaseadamlikedecysin1adamdec1incolonicsubepithelialpdgfracellsisanewmarkerforinflammatoryboweldisease AT rubinsamueljs metalloendopeptidaseadamlikedecysin1adamdec1incolonicsubepithelialpdgfracellsisanewmarkerforinflammatoryboweldisease AT gottfriedblackmoreandres metalloendopeptidaseadamlikedecysin1adamdec1incolonicsubepithelialpdgfracellsisanewmarkerforinflammatoryboweldisease AT beckerlaren metalloendopeptidaseadamlikedecysin1adamdec1incolonicsubepithelialpdgfracellsisanewmarkerforinflammatoryboweldisease AT habtezionaida metalloendopeptidaseadamlikedecysin1adamdec1incolonicsubepithelialpdgfracellsisanewmarkerforinflammatoryboweldisease AT sanderskentonm metalloendopeptidaseadamlikedecysin1adamdec1incolonicsubepithelialpdgfracellsisanewmarkerforinflammatoryboweldisease AT roseungil metalloendopeptidaseadamlikedecysin1adamdec1incolonicsubepithelialpdgfracellsisanewmarkerforinflammatoryboweldisease |