Cargando…

Metalloendopeptidase ADAM-like Decysin 1 (ADAMDEC1) in Colonic Subepithelial PDGFRα(+) Cells Is a New Marker for Inflammatory Bowel Disease

Metalloendopeptidase ADAM-Like Decysin 1 (ADAMDEC1) is an anti-inflammatory peptidase that is almost exclusively expressed in the gastrointestinal (GI) tract. We have recently found abundant and selective expression of Adamdec1 in colonic mucosal PDGFRα(+) cells. However, the cellular origin for thi...

Descripción completa

Detalles Bibliográficos
Autores principales: Ha, Se Eun, Jorgensen, Brian G., Wei, Lai, Jin, Byungchang, Kim, Min-Seob, Poudrier, Sandra M., Singh, Rajan, Bartlett, Allison, Zogg, Hannah, Kim, Sei, Baek, Gain, Kurahashi, Masaaki, Lee, Moon-Young, Kim, Yong-Sung, Choi, Suck-Chei, Sasse, Kent C., Rubin, Samuel J. S., Gottfried-Blackmore, Andres, Becker, Laren, Habtezion, Aida, Sanders, Kenton M., Ro, Seungil
Formato: Online Artículo Texto
Lenguaje:English
Publicado: MDPI 2022
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9103908/
https://www.ncbi.nlm.nih.gov/pubmed/35563399
http://dx.doi.org/10.3390/ijms23095007
_version_ 1784707664996990976
author Ha, Se Eun
Jorgensen, Brian G.
Wei, Lai
Jin, Byungchang
Kim, Min-Seob
Poudrier, Sandra M.
Singh, Rajan
Bartlett, Allison
Zogg, Hannah
Kim, Sei
Baek, Gain
Kurahashi, Masaaki
Lee, Moon-Young
Kim, Yong-Sung
Choi, Suck-Chei
Sasse, Kent C.
Rubin, Samuel J. S.
Gottfried-Blackmore, Andres
Becker, Laren
Habtezion, Aida
Sanders, Kenton M.
Ro, Seungil
author_facet Ha, Se Eun
Jorgensen, Brian G.
Wei, Lai
Jin, Byungchang
Kim, Min-Seob
Poudrier, Sandra M.
Singh, Rajan
Bartlett, Allison
Zogg, Hannah
Kim, Sei
Baek, Gain
Kurahashi, Masaaki
Lee, Moon-Young
Kim, Yong-Sung
Choi, Suck-Chei
Sasse, Kent C.
Rubin, Samuel J. S.
Gottfried-Blackmore, Andres
Becker, Laren
Habtezion, Aida
Sanders, Kenton M.
Ro, Seungil
author_sort Ha, Se Eun
collection PubMed
description Metalloendopeptidase ADAM-Like Decysin 1 (ADAMDEC1) is an anti-inflammatory peptidase that is almost exclusively expressed in the gastrointestinal (GI) tract. We have recently found abundant and selective expression of Adamdec1 in colonic mucosal PDGFRα(+) cells. However, the cellular origin for this gene expression is controversial as it is also known to be expressed in intestinal macrophages. We found that Adamdec1 mRNAs were selectively expressed in colonic mucosal subepithelial PDGFRα(+) cells. ADAMDEC1 protein was mainly released from PDGFRα(+) cells and accumulated in the mucosal layer lamina propria space near the epithelial basement membrane. PDGFRα(+) cells significantly overexpressed Adamdec1 mRNAs and protein in DSS-induced colitis mice. Adamdec1 was predominantly expressed in CD45(−) PDGFRα(+) cells in DSS-induced colitis mice, with only minimal expression in CD45(+) CD64(+) macrophages. Additionally, overexpression of both ADAMDEC1 mRNA and protein was consistently observed in PDGFRα(+) cells, but not in CD64(+) macrophages found in human colonic mucosal tissue affected by Crohn’s disease. In summary, PDGFRα(+) cells selectively express ADAMDEC1, which is localized to the colon mucosa layer. ADAMDEC1 expression significantly increases in DSS-induced colitis affected mice and Crohn’s disease affected human tissue, suggesting that this gene can serve as a diagnostic and/or therapeutic target for intestinal inflammation and Crohn’s disease.
format Online
Article
Text
id pubmed-9103908
institution National Center for Biotechnology Information
language English
publishDate 2022
publisher MDPI
record_format MEDLINE/PubMed
spelling pubmed-91039082022-05-14 Metalloendopeptidase ADAM-like Decysin 1 (ADAMDEC1) in Colonic Subepithelial PDGFRα(+) Cells Is a New Marker for Inflammatory Bowel Disease Ha, Se Eun Jorgensen, Brian G. Wei, Lai Jin, Byungchang Kim, Min-Seob Poudrier, Sandra M. Singh, Rajan Bartlett, Allison Zogg, Hannah Kim, Sei Baek, Gain Kurahashi, Masaaki Lee, Moon-Young Kim, Yong-Sung Choi, Suck-Chei Sasse, Kent C. Rubin, Samuel J. S. Gottfried-Blackmore, Andres Becker, Laren Habtezion, Aida Sanders, Kenton M. Ro, Seungil Int J Mol Sci Article Metalloendopeptidase ADAM-Like Decysin 1 (ADAMDEC1) is an anti-inflammatory peptidase that is almost exclusively expressed in the gastrointestinal (GI) tract. We have recently found abundant and selective expression of Adamdec1 in colonic mucosal PDGFRα(+) cells. However, the cellular origin for this gene expression is controversial as it is also known to be expressed in intestinal macrophages. We found that Adamdec1 mRNAs were selectively expressed in colonic mucosal subepithelial PDGFRα(+) cells. ADAMDEC1 protein was mainly released from PDGFRα(+) cells and accumulated in the mucosal layer lamina propria space near the epithelial basement membrane. PDGFRα(+) cells significantly overexpressed Adamdec1 mRNAs and protein in DSS-induced colitis mice. Adamdec1 was predominantly expressed in CD45(−) PDGFRα(+) cells in DSS-induced colitis mice, with only minimal expression in CD45(+) CD64(+) macrophages. Additionally, overexpression of both ADAMDEC1 mRNA and protein was consistently observed in PDGFRα(+) cells, but not in CD64(+) macrophages found in human colonic mucosal tissue affected by Crohn’s disease. In summary, PDGFRα(+) cells selectively express ADAMDEC1, which is localized to the colon mucosa layer. ADAMDEC1 expression significantly increases in DSS-induced colitis affected mice and Crohn’s disease affected human tissue, suggesting that this gene can serve as a diagnostic and/or therapeutic target for intestinal inflammation and Crohn’s disease. MDPI 2022-04-30 /pmc/articles/PMC9103908/ /pubmed/35563399 http://dx.doi.org/10.3390/ijms23095007 Text en © 2022 by the authors. https://creativecommons.org/licenses/by/4.0/Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
spellingShingle Article
Ha, Se Eun
Jorgensen, Brian G.
Wei, Lai
Jin, Byungchang
Kim, Min-Seob
Poudrier, Sandra M.
Singh, Rajan
Bartlett, Allison
Zogg, Hannah
Kim, Sei
Baek, Gain
Kurahashi, Masaaki
Lee, Moon-Young
Kim, Yong-Sung
Choi, Suck-Chei
Sasse, Kent C.
Rubin, Samuel J. S.
Gottfried-Blackmore, Andres
Becker, Laren
Habtezion, Aida
Sanders, Kenton M.
Ro, Seungil
Metalloendopeptidase ADAM-like Decysin 1 (ADAMDEC1) in Colonic Subepithelial PDGFRα(+) Cells Is a New Marker for Inflammatory Bowel Disease
title Metalloendopeptidase ADAM-like Decysin 1 (ADAMDEC1) in Colonic Subepithelial PDGFRα(+) Cells Is a New Marker for Inflammatory Bowel Disease
title_full Metalloendopeptidase ADAM-like Decysin 1 (ADAMDEC1) in Colonic Subepithelial PDGFRα(+) Cells Is a New Marker for Inflammatory Bowel Disease
title_fullStr Metalloendopeptidase ADAM-like Decysin 1 (ADAMDEC1) in Colonic Subepithelial PDGFRα(+) Cells Is a New Marker for Inflammatory Bowel Disease
title_full_unstemmed Metalloendopeptidase ADAM-like Decysin 1 (ADAMDEC1) in Colonic Subepithelial PDGFRα(+) Cells Is a New Marker for Inflammatory Bowel Disease
title_short Metalloendopeptidase ADAM-like Decysin 1 (ADAMDEC1) in Colonic Subepithelial PDGFRα(+) Cells Is a New Marker for Inflammatory Bowel Disease
title_sort metalloendopeptidase adam-like decysin 1 (adamdec1) in colonic subepithelial pdgfrα(+) cells is a new marker for inflammatory bowel disease
topic Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9103908/
https://www.ncbi.nlm.nih.gov/pubmed/35563399
http://dx.doi.org/10.3390/ijms23095007
work_keys_str_mv AT haseeun metalloendopeptidaseadamlikedecysin1adamdec1incolonicsubepithelialpdgfracellsisanewmarkerforinflammatoryboweldisease
AT jorgensenbriang metalloendopeptidaseadamlikedecysin1adamdec1incolonicsubepithelialpdgfracellsisanewmarkerforinflammatoryboweldisease
AT weilai metalloendopeptidaseadamlikedecysin1adamdec1incolonicsubepithelialpdgfracellsisanewmarkerforinflammatoryboweldisease
AT jinbyungchang metalloendopeptidaseadamlikedecysin1adamdec1incolonicsubepithelialpdgfracellsisanewmarkerforinflammatoryboweldisease
AT kimminseob metalloendopeptidaseadamlikedecysin1adamdec1incolonicsubepithelialpdgfracellsisanewmarkerforinflammatoryboweldisease
AT poudriersandram metalloendopeptidaseadamlikedecysin1adamdec1incolonicsubepithelialpdgfracellsisanewmarkerforinflammatoryboweldisease
AT singhrajan metalloendopeptidaseadamlikedecysin1adamdec1incolonicsubepithelialpdgfracellsisanewmarkerforinflammatoryboweldisease
AT bartlettallison metalloendopeptidaseadamlikedecysin1adamdec1incolonicsubepithelialpdgfracellsisanewmarkerforinflammatoryboweldisease
AT zogghannah metalloendopeptidaseadamlikedecysin1adamdec1incolonicsubepithelialpdgfracellsisanewmarkerforinflammatoryboweldisease
AT kimsei metalloendopeptidaseadamlikedecysin1adamdec1incolonicsubepithelialpdgfracellsisanewmarkerforinflammatoryboweldisease
AT baekgain metalloendopeptidaseadamlikedecysin1adamdec1incolonicsubepithelialpdgfracellsisanewmarkerforinflammatoryboweldisease
AT kurahashimasaaki metalloendopeptidaseadamlikedecysin1adamdec1incolonicsubepithelialpdgfracellsisanewmarkerforinflammatoryboweldisease
AT leemoonyoung metalloendopeptidaseadamlikedecysin1adamdec1incolonicsubepithelialpdgfracellsisanewmarkerforinflammatoryboweldisease
AT kimyongsung metalloendopeptidaseadamlikedecysin1adamdec1incolonicsubepithelialpdgfracellsisanewmarkerforinflammatoryboweldisease
AT choisuckchei metalloendopeptidaseadamlikedecysin1adamdec1incolonicsubepithelialpdgfracellsisanewmarkerforinflammatoryboweldisease
AT sassekentc metalloendopeptidaseadamlikedecysin1adamdec1incolonicsubepithelialpdgfracellsisanewmarkerforinflammatoryboweldisease
AT rubinsamueljs metalloendopeptidaseadamlikedecysin1adamdec1incolonicsubepithelialpdgfracellsisanewmarkerforinflammatoryboweldisease
AT gottfriedblackmoreandres metalloendopeptidaseadamlikedecysin1adamdec1incolonicsubepithelialpdgfracellsisanewmarkerforinflammatoryboweldisease
AT beckerlaren metalloendopeptidaseadamlikedecysin1adamdec1incolonicsubepithelialpdgfracellsisanewmarkerforinflammatoryboweldisease
AT habtezionaida metalloendopeptidaseadamlikedecysin1adamdec1incolonicsubepithelialpdgfracellsisanewmarkerforinflammatoryboweldisease
AT sanderskentonm metalloendopeptidaseadamlikedecysin1adamdec1incolonicsubepithelialpdgfracellsisanewmarkerforinflammatoryboweldisease
AT roseungil metalloendopeptidaseadamlikedecysin1adamdec1incolonicsubepithelialpdgfracellsisanewmarkerforinflammatoryboweldisease