Cargando…

Do social relationships mediate or moderate social inequalities in health? A systematic review protocol

INTRODUCTION: Explanations for health inequalities include material, behavioural and psychosocial pathways. Social relationships are an important determinant of health, and research has consistently found that a lack of support networks may diminish favourable health outcomes. There is some evidence...

Descripción completa

Detalles Bibliográficos
Autores principales: Khaliq, Nadia, McMunn, Anne, Machuca-Vargas, Carolina, Heilmann, Anja
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2022
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9107128/
https://www.ncbi.nlm.nih.gov/pubmed/35562839
http://dx.doi.org/10.1186/s13643-022-01973-w
_version_ 1784708424052768768
author Khaliq, Nadia
McMunn, Anne
Machuca-Vargas, Carolina
Heilmann, Anja
author_facet Khaliq, Nadia
McMunn, Anne
Machuca-Vargas, Carolina
Heilmann, Anja
author_sort Khaliq, Nadia
collection PubMed
description INTRODUCTION: Explanations for health inequalities include material, behavioural and psychosocial pathways. Social relationships are an important determinant of health, and research has consistently found that a lack of support networks may diminish favourable health outcomes. There is some evidence that social network structures, partly shaped by socioeconomic factors, contribute to health inequalities. This protocol will summarise the systematic review process. METHODS AND ANALYSES: The Systematic review will be reported according to the Preferred Reporting Items for Systematic Reviews and Meta-Analyses guidelines. An electronic database search of MEDLINE, Embase Classic + Embase and PsychINFO using the OvidSP platform will be undertaken. Databases will be searched from the earliest date of entry until 10 June 2022. Articles that have quantitatively assessed the role of social relationships in mediating or moderating health inequalities will be included and any health outcome (mental/physical) will be considered. The database search will be supplemented by reference list screening of all relevant full-text articles identified through the search. Two independent reviewers will be responsible for screening of articles, data extraction and assessment of bias. Observational studies will be risk assessed for bias using a modified version of the Newcastle-Ottawa Quality Assessment Scale, and intervention studies will be assessed using the revised Cochrane risk-of-bias tool. It is anticipated that the eligible studies will be highly variable; therefore, a meta-analysis will only be considered if the available data of the selected studies are similar. If the studies are too heterogeneous, a narrative synthesis of the extracted data will be presented. CONCLUSION: The results of the systematic review will examine the link between social relationships and health inequalities. The findings of the review will identify gaps in knowledge where further research is needed. SYSTEMATIC REVIEW REGISTRATION: PROSPERO CRD42020181706 SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s13643-022-01973-w.
format Online
Article
Text
id pubmed-9107128
institution National Center for Biotechnology Information
language English
publishDate 2022
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-91071282022-05-15 Do social relationships mediate or moderate social inequalities in health? A systematic review protocol Khaliq, Nadia McMunn, Anne Machuca-Vargas, Carolina Heilmann, Anja Syst Rev Protocol INTRODUCTION: Explanations for health inequalities include material, behavioural and psychosocial pathways. Social relationships are an important determinant of health, and research has consistently found that a lack of support networks may diminish favourable health outcomes. There is some evidence that social network structures, partly shaped by socioeconomic factors, contribute to health inequalities. This protocol will summarise the systematic review process. METHODS AND ANALYSES: The Systematic review will be reported according to the Preferred Reporting Items for Systematic Reviews and Meta-Analyses guidelines. An electronic database search of MEDLINE, Embase Classic + Embase and PsychINFO using the OvidSP platform will be undertaken. Databases will be searched from the earliest date of entry until 10 June 2022. Articles that have quantitatively assessed the role of social relationships in mediating or moderating health inequalities will be included and any health outcome (mental/physical) will be considered. The database search will be supplemented by reference list screening of all relevant full-text articles identified through the search. Two independent reviewers will be responsible for screening of articles, data extraction and assessment of bias. Observational studies will be risk assessed for bias using a modified version of the Newcastle-Ottawa Quality Assessment Scale, and intervention studies will be assessed using the revised Cochrane risk-of-bias tool. It is anticipated that the eligible studies will be highly variable; therefore, a meta-analysis will only be considered if the available data of the selected studies are similar. If the studies are too heterogeneous, a narrative synthesis of the extracted data will be presented. CONCLUSION: The results of the systematic review will examine the link between social relationships and health inequalities. The findings of the review will identify gaps in knowledge where further research is needed. SYSTEMATIC REVIEW REGISTRATION: PROSPERO CRD42020181706 SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s13643-022-01973-w. BioMed Central 2022-05-14 /pmc/articles/PMC9107128/ /pubmed/35562839 http://dx.doi.org/10.1186/s13643-022-01973-w Text en © The Author(s) 2022 https://creativecommons.org/licenses/by/4.0/Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data.
spellingShingle Protocol
Khaliq, Nadia
McMunn, Anne
Machuca-Vargas, Carolina
Heilmann, Anja
Do social relationships mediate or moderate social inequalities in health? A systematic review protocol
title Do social relationships mediate or moderate social inequalities in health? A systematic review protocol
title_full Do social relationships mediate or moderate social inequalities in health? A systematic review protocol
title_fullStr Do social relationships mediate or moderate social inequalities in health? A systematic review protocol
title_full_unstemmed Do social relationships mediate or moderate social inequalities in health? A systematic review protocol
title_short Do social relationships mediate or moderate social inequalities in health? A systematic review protocol
title_sort do social relationships mediate or moderate social inequalities in health? a systematic review protocol
topic Protocol
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9107128/
https://www.ncbi.nlm.nih.gov/pubmed/35562839
http://dx.doi.org/10.1186/s13643-022-01973-w
work_keys_str_mv AT khaliqnadia dosocialrelationshipsmediateormoderatesocialinequalitiesinhealthasystematicreviewprotocol
AT mcmunnanne dosocialrelationshipsmediateormoderatesocialinequalitiesinhealthasystematicreviewprotocol
AT machucavargascarolina dosocialrelationshipsmediateormoderatesocialinequalitiesinhealthasystematicreviewprotocol
AT heilmannanja dosocialrelationshipsmediateormoderatesocialinequalitiesinhealthasystematicreviewprotocol