Cargando…
Sex differences in HIV testing among elders in Sub-Saharan Africa: a systematic review protocol
BACKGROUND: Elders (age 50+) HIV demographic (age and sex) data are essential to better understand their HIV service utilization and develop appropriate evidence-based responses and policies. Despite a significant prevalence rate of HIV and growing numbers of this population group, data are still sc...
Autores principales: | , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2022
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9109370/ https://www.ncbi.nlm.nih.gov/pubmed/35578357 http://dx.doi.org/10.1186/s13643-022-01968-7 |
_version_ | 1784708885865562112 |
---|---|
author | Gebremeskel, Akalewold T. Omonaiye, Olumuyiwa Yaya, Sanni |
author_facet | Gebremeskel, Akalewold T. Omonaiye, Olumuyiwa Yaya, Sanni |
author_sort | Gebremeskel, Akalewold T. |
collection | PubMed |
description | BACKGROUND: Elders (age 50+) HIV demographic (age and sex) data are essential to better understand their HIV service utilization and develop appropriate evidence-based responses and policies. Despite a significant prevalence rate of HIV and growing numbers of this population group, data are still scarce, and studies have neglected them in Sub-Saharan Africa. The aim of this protocol is to outline the methodological process of a systematic review that will gather qualitative and quantitative data to critically examine sex differences in HIV testing among elders (age 50+) in Sub-Saharan Africa. METHODS: This protocol adheres to the PRISMA-P reporting guidelines. We will conduct a systematic database search to retrieve all observational and qualitative studies. Electronic search strategies will be developed for MEDLINE, EMBASE, Web of Science, Global Health, and CINAHL for studies reporting HIV data. Two reviewers will independently screen all citations, full-text articles, and abstract data. The search strategy will consist of free-text and Medical Subject Headings (MeSH) terms. Search terms for elders (50+) will include the following: “elders”, “older adults”, “aged”, “geriatric” and “seniors”. The primary outcome of interest is sex differences in the uptake of HIV counselling and testing (HCT). The study methodological quality (or bias) will be appraised using appropriate tools. Screening, data extraction, and assessments of risk of bias will be performed independently by two reviewers. Narrative synthesis will be conducted with studies that are compatible based on population and outcome. As it will be a systematic review, without human participants’ involvement, there will be no requirement for ethical approval. DISCUSSION: The systematic review will present key evidence on sex differences in HIV testing among elders in Sub-Saharan Africa. The findings will be used to inform program developers, policymakers, and other stakeholders to enhance sex disaggregated HIV data to improve access to HIV counselling and testing service for elders in Sub-Saharan Africa. The final manuscript will be disseminated through a peer-reviewed journal and scientific conferences. SYSTEMATIC REVIEW REGISTRATION: PROSPERO: CRD42020172737. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s13643-022-01968-7. |
format | Online Article Text |
id | pubmed-9109370 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2022 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-91093702022-05-17 Sex differences in HIV testing among elders in Sub-Saharan Africa: a systematic review protocol Gebremeskel, Akalewold T. Omonaiye, Olumuyiwa Yaya, Sanni Syst Rev Protocol BACKGROUND: Elders (age 50+) HIV demographic (age and sex) data are essential to better understand their HIV service utilization and develop appropriate evidence-based responses and policies. Despite a significant prevalence rate of HIV and growing numbers of this population group, data are still scarce, and studies have neglected them in Sub-Saharan Africa. The aim of this protocol is to outline the methodological process of a systematic review that will gather qualitative and quantitative data to critically examine sex differences in HIV testing among elders (age 50+) in Sub-Saharan Africa. METHODS: This protocol adheres to the PRISMA-P reporting guidelines. We will conduct a systematic database search to retrieve all observational and qualitative studies. Electronic search strategies will be developed for MEDLINE, EMBASE, Web of Science, Global Health, and CINAHL for studies reporting HIV data. Two reviewers will independently screen all citations, full-text articles, and abstract data. The search strategy will consist of free-text and Medical Subject Headings (MeSH) terms. Search terms for elders (50+) will include the following: “elders”, “older adults”, “aged”, “geriatric” and “seniors”. The primary outcome of interest is sex differences in the uptake of HIV counselling and testing (HCT). The study methodological quality (or bias) will be appraised using appropriate tools. Screening, data extraction, and assessments of risk of bias will be performed independently by two reviewers. Narrative synthesis will be conducted with studies that are compatible based on population and outcome. As it will be a systematic review, without human participants’ involvement, there will be no requirement for ethical approval. DISCUSSION: The systematic review will present key evidence on sex differences in HIV testing among elders in Sub-Saharan Africa. The findings will be used to inform program developers, policymakers, and other stakeholders to enhance sex disaggregated HIV data to improve access to HIV counselling and testing service for elders in Sub-Saharan Africa. The final manuscript will be disseminated through a peer-reviewed journal and scientific conferences. SYSTEMATIC REVIEW REGISTRATION: PROSPERO: CRD42020172737. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s13643-022-01968-7. BioMed Central 2022-05-16 /pmc/articles/PMC9109370/ /pubmed/35578357 http://dx.doi.org/10.1186/s13643-022-01968-7 Text en © The Author(s) 2022 https://creativecommons.org/licenses/by/4.0/Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data. |
spellingShingle | Protocol Gebremeskel, Akalewold T. Omonaiye, Olumuyiwa Yaya, Sanni Sex differences in HIV testing among elders in Sub-Saharan Africa: a systematic review protocol |
title | Sex differences in HIV testing among elders in Sub-Saharan Africa: a systematic review protocol |
title_full | Sex differences in HIV testing among elders in Sub-Saharan Africa: a systematic review protocol |
title_fullStr | Sex differences in HIV testing among elders in Sub-Saharan Africa: a systematic review protocol |
title_full_unstemmed | Sex differences in HIV testing among elders in Sub-Saharan Africa: a systematic review protocol |
title_short | Sex differences in HIV testing among elders in Sub-Saharan Africa: a systematic review protocol |
title_sort | sex differences in hiv testing among elders in sub-saharan africa: a systematic review protocol |
topic | Protocol |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9109370/ https://www.ncbi.nlm.nih.gov/pubmed/35578357 http://dx.doi.org/10.1186/s13643-022-01968-7 |
work_keys_str_mv | AT gebremeskelakalewoldt sexdifferencesinhivtestingamongeldersinsubsaharanafricaasystematicreviewprotocol AT omonaiyeolumuyiwa sexdifferencesinhivtestingamongeldersinsubsaharanafricaasystematicreviewprotocol AT yayasanni sexdifferencesinhivtestingamongeldersinsubsaharanafricaasystematicreviewprotocol |