Cargando…
Invisible experts: a systematic review & thematic synthesis of informal carer experiences of inpatient mental health care
BACKGROUND: The negative impact of caregiving on carers’ physical and psychological wellbeing is well documented. Carers of mental health inpatients have particularly negative experiences and largely report being dissatisfied with how they and their loved one are treated during inpatient care. It re...
Autores principales: | , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2022
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9121622/ https://www.ncbi.nlm.nih.gov/pubmed/35596170 http://dx.doi.org/10.1186/s12888-022-03872-9 |
_version_ | 1784711191328718848 |
---|---|
author | Abou Seif, Nada Wood, Lisa Morant, Nicola |
author_facet | Abou Seif, Nada Wood, Lisa Morant, Nicola |
author_sort | Abou Seif, Nada |
collection | PubMed |
description | BACKGROUND: The negative impact of caregiving on carers’ physical and psychological wellbeing is well documented. Carers of mental health inpatients have particularly negative experiences and largely report being dissatisfied with how they and their loved one are treated during inpatient care. It remains unclear why, despite policies intended to improve inpatient experiences. A comprehensive review of carers’ inpatient experiences is needed to understand carer needs. As such, we aimed to conduct a systematic review and thematic synthesis of carer experiences of inpatient mental health care. METHODS: We searched MEDLINE, PsycINFO, Embase and CINAHL for qualitative studies examining carer experiences of mental health inpatient care. Searches were supplemented by reference list screening and forward citation tracking of included studies. Results were synthesised using thematic synthesis. Our protocol was registered on PROSPERO (CRD42020197904) and our review followed Preferred Reporting Items for Systematic Reviews and Meta-Analyses (PRISMA) guidelines. FINDINGS: Twelve studies were included from 6 countries. Four themes were identified: the emotional journey of inpatient care; invisible experts; carer concerns about quality of care for their loved one; and relationships and partnership between carers, service users and staff. INTERPRETATION: Greater attention should be paid to ensure carers are well-supported, well-informed, and included in care. More emphasis must be placed on fostering positive relationships between carers, service users and staff and in facilitating continuity of care across inpatient and community services to provide carers with a sense of security and predictability. Further research is needed to explore differences in experiences based on carer and service user characteristics and global context, alongside co-production with carers to develop and evaluate future guidelines and policies. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12888-022-03872-9. |
format | Online Article Text |
id | pubmed-9121622 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2022 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-91216222022-05-21 Invisible experts: a systematic review & thematic synthesis of informal carer experiences of inpatient mental health care Abou Seif, Nada Wood, Lisa Morant, Nicola BMC Psychiatry Research BACKGROUND: The negative impact of caregiving on carers’ physical and psychological wellbeing is well documented. Carers of mental health inpatients have particularly negative experiences and largely report being dissatisfied with how they and their loved one are treated during inpatient care. It remains unclear why, despite policies intended to improve inpatient experiences. A comprehensive review of carers’ inpatient experiences is needed to understand carer needs. As such, we aimed to conduct a systematic review and thematic synthesis of carer experiences of inpatient mental health care. METHODS: We searched MEDLINE, PsycINFO, Embase and CINAHL for qualitative studies examining carer experiences of mental health inpatient care. Searches were supplemented by reference list screening and forward citation tracking of included studies. Results were synthesised using thematic synthesis. Our protocol was registered on PROSPERO (CRD42020197904) and our review followed Preferred Reporting Items for Systematic Reviews and Meta-Analyses (PRISMA) guidelines. FINDINGS: Twelve studies were included from 6 countries. Four themes were identified: the emotional journey of inpatient care; invisible experts; carer concerns about quality of care for their loved one; and relationships and partnership between carers, service users and staff. INTERPRETATION: Greater attention should be paid to ensure carers are well-supported, well-informed, and included in care. More emphasis must be placed on fostering positive relationships between carers, service users and staff and in facilitating continuity of care across inpatient and community services to provide carers with a sense of security and predictability. Further research is needed to explore differences in experiences based on carer and service user characteristics and global context, alongside co-production with carers to develop and evaluate future guidelines and policies. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12888-022-03872-9. BioMed Central 2022-05-20 /pmc/articles/PMC9121622/ /pubmed/35596170 http://dx.doi.org/10.1186/s12888-022-03872-9 Text en © The Author(s) 2022 https://creativecommons.org/licenses/by/4.0/Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data. |
spellingShingle | Research Abou Seif, Nada Wood, Lisa Morant, Nicola Invisible experts: a systematic review & thematic synthesis of informal carer experiences of inpatient mental health care |
title | Invisible experts: a systematic review & thematic synthesis of informal carer experiences of inpatient mental health care |
title_full | Invisible experts: a systematic review & thematic synthesis of informal carer experiences of inpatient mental health care |
title_fullStr | Invisible experts: a systematic review & thematic synthesis of informal carer experiences of inpatient mental health care |
title_full_unstemmed | Invisible experts: a systematic review & thematic synthesis of informal carer experiences of inpatient mental health care |
title_short | Invisible experts: a systematic review & thematic synthesis of informal carer experiences of inpatient mental health care |
title_sort | invisible experts: a systematic review & thematic synthesis of informal carer experiences of inpatient mental health care |
topic | Research |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9121622/ https://www.ncbi.nlm.nih.gov/pubmed/35596170 http://dx.doi.org/10.1186/s12888-022-03872-9 |
work_keys_str_mv | AT abouseifnada invisibleexpertsasystematicreviewthematicsynthesisofinformalcarerexperiencesofinpatientmentalhealthcare AT woodlisa invisibleexpertsasystematicreviewthematicsynthesisofinformalcarerexperiencesofinpatientmentalhealthcare AT morantnicola invisibleexpertsasystematicreviewthematicsynthesisofinformalcarerexperiencesofinpatientmentalhealthcare |