Cargando…

Advances in clinical applications of kisspeptin-GnRH pathway in female reproduction

BACKGROUND: Kisspeptin is the leading upstream regulator of pulsatile and surge Gonadotrophin-Releasing Hormone secretion (GnRH) in the hypothalamus, which acts as the key governor of the hypothalamic-pituitary-ovary axis. MAIN TEXT: Exogenous kisspeptin or its receptor agonist can stimulate GnRH re...

Descripción completa

Detalles Bibliográficos
Autores principales: Hu, Kai-Lun, Chen, Zimiao, Li, Xiaoxue, Cai, Enci, Yang, Haiyan, Chen, Yi, Wang, Congying, Ju, Liping, Deng, Wenhai, Mu, Liangshan
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2022
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9125910/
https://www.ncbi.nlm.nih.gov/pubmed/35606759
http://dx.doi.org/10.1186/s12958-022-00953-y
_version_ 1784712029775331328
author Hu, Kai-Lun
Chen, Zimiao
Li, Xiaoxue
Cai, Enci
Yang, Haiyan
Chen, Yi
Wang, Congying
Ju, Liping
Deng, Wenhai
Mu, Liangshan
author_facet Hu, Kai-Lun
Chen, Zimiao
Li, Xiaoxue
Cai, Enci
Yang, Haiyan
Chen, Yi
Wang, Congying
Ju, Liping
Deng, Wenhai
Mu, Liangshan
author_sort Hu, Kai-Lun
collection PubMed
description BACKGROUND: Kisspeptin is the leading upstream regulator of pulsatile and surge Gonadotrophin-Releasing Hormone secretion (GnRH) in the hypothalamus, which acts as the key governor of the hypothalamic-pituitary-ovary axis. MAIN TEXT: Exogenous kisspeptin or its receptor agonist can stimulate GnRH release and subsequent physiological gonadotropin secretion in humans. Based on the role of kisspeptin in the hypothalamus, a broad application of kisspeptin and its receptor agonist has been recently uncovered in humans, including central control of ovulation, oocyte maturation (particularly in women at a high risk of ovarian hyperstimulation syndrome), test for GnRH neuronal function, and gatekeepers of puberty onset. In addition, the kisspeptin analogs, such as TAK-448, showed promising agonistic activity in healthy women as well as in women with hypothalamic amenorrhoea or polycystic ovary syndrome. CONCLUSION: More clinical trials should focus on the therapeutic effect of kisspeptin, its receptor agonist and antagonist in women with reproductive disorders, such as hypothalamic amenorrhoea, polycystic ovary syndrome, and endometriosis.
format Online
Article
Text
id pubmed-9125910
institution National Center for Biotechnology Information
language English
publishDate 2022
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-91259102022-05-24 Advances in clinical applications of kisspeptin-GnRH pathway in female reproduction Hu, Kai-Lun Chen, Zimiao Li, Xiaoxue Cai, Enci Yang, Haiyan Chen, Yi Wang, Congying Ju, Liping Deng, Wenhai Mu, Liangshan Reprod Biol Endocrinol Review BACKGROUND: Kisspeptin is the leading upstream regulator of pulsatile and surge Gonadotrophin-Releasing Hormone secretion (GnRH) in the hypothalamus, which acts as the key governor of the hypothalamic-pituitary-ovary axis. MAIN TEXT: Exogenous kisspeptin or its receptor agonist can stimulate GnRH release and subsequent physiological gonadotropin secretion in humans. Based on the role of kisspeptin in the hypothalamus, a broad application of kisspeptin and its receptor agonist has been recently uncovered in humans, including central control of ovulation, oocyte maturation (particularly in women at a high risk of ovarian hyperstimulation syndrome), test for GnRH neuronal function, and gatekeepers of puberty onset. In addition, the kisspeptin analogs, such as TAK-448, showed promising agonistic activity in healthy women as well as in women with hypothalamic amenorrhoea or polycystic ovary syndrome. CONCLUSION: More clinical trials should focus on the therapeutic effect of kisspeptin, its receptor agonist and antagonist in women with reproductive disorders, such as hypothalamic amenorrhoea, polycystic ovary syndrome, and endometriosis. BioMed Central 2022-05-23 /pmc/articles/PMC9125910/ /pubmed/35606759 http://dx.doi.org/10.1186/s12958-022-00953-y Text en © The Author(s) 2022 https://creativecommons.org/licenses/by/4.0/Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data.
spellingShingle Review
Hu, Kai-Lun
Chen, Zimiao
Li, Xiaoxue
Cai, Enci
Yang, Haiyan
Chen, Yi
Wang, Congying
Ju, Liping
Deng, Wenhai
Mu, Liangshan
Advances in clinical applications of kisspeptin-GnRH pathway in female reproduction
title Advances in clinical applications of kisspeptin-GnRH pathway in female reproduction
title_full Advances in clinical applications of kisspeptin-GnRH pathway in female reproduction
title_fullStr Advances in clinical applications of kisspeptin-GnRH pathway in female reproduction
title_full_unstemmed Advances in clinical applications of kisspeptin-GnRH pathway in female reproduction
title_short Advances in clinical applications of kisspeptin-GnRH pathway in female reproduction
title_sort advances in clinical applications of kisspeptin-gnrh pathway in female reproduction
topic Review
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9125910/
https://www.ncbi.nlm.nih.gov/pubmed/35606759
http://dx.doi.org/10.1186/s12958-022-00953-y
work_keys_str_mv AT hukailun advancesinclinicalapplicationsofkisspeptingnrhpathwayinfemalereproduction
AT chenzimiao advancesinclinicalapplicationsofkisspeptingnrhpathwayinfemalereproduction
AT lixiaoxue advancesinclinicalapplicationsofkisspeptingnrhpathwayinfemalereproduction
AT caienci advancesinclinicalapplicationsofkisspeptingnrhpathwayinfemalereproduction
AT yanghaiyan advancesinclinicalapplicationsofkisspeptingnrhpathwayinfemalereproduction
AT chenyi advancesinclinicalapplicationsofkisspeptingnrhpathwayinfemalereproduction
AT wangcongying advancesinclinicalapplicationsofkisspeptingnrhpathwayinfemalereproduction
AT juliping advancesinclinicalapplicationsofkisspeptingnrhpathwayinfemalereproduction
AT dengwenhai advancesinclinicalapplicationsofkisspeptingnrhpathwayinfemalereproduction
AT muliangshan advancesinclinicalapplicationsofkisspeptingnrhpathwayinfemalereproduction