Cargando…
Advances in clinical applications of kisspeptin-GnRH pathway in female reproduction
BACKGROUND: Kisspeptin is the leading upstream regulator of pulsatile and surge Gonadotrophin-Releasing Hormone secretion (GnRH) in the hypothalamus, which acts as the key governor of the hypothalamic-pituitary-ovary axis. MAIN TEXT: Exogenous kisspeptin or its receptor agonist can stimulate GnRH re...
Autores principales: | , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2022
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9125910/ https://www.ncbi.nlm.nih.gov/pubmed/35606759 http://dx.doi.org/10.1186/s12958-022-00953-y |
_version_ | 1784712029775331328 |
---|---|
author | Hu, Kai-Lun Chen, Zimiao Li, Xiaoxue Cai, Enci Yang, Haiyan Chen, Yi Wang, Congying Ju, Liping Deng, Wenhai Mu, Liangshan |
author_facet | Hu, Kai-Lun Chen, Zimiao Li, Xiaoxue Cai, Enci Yang, Haiyan Chen, Yi Wang, Congying Ju, Liping Deng, Wenhai Mu, Liangshan |
author_sort | Hu, Kai-Lun |
collection | PubMed |
description | BACKGROUND: Kisspeptin is the leading upstream regulator of pulsatile and surge Gonadotrophin-Releasing Hormone secretion (GnRH) in the hypothalamus, which acts as the key governor of the hypothalamic-pituitary-ovary axis. MAIN TEXT: Exogenous kisspeptin or its receptor agonist can stimulate GnRH release and subsequent physiological gonadotropin secretion in humans. Based on the role of kisspeptin in the hypothalamus, a broad application of kisspeptin and its receptor agonist has been recently uncovered in humans, including central control of ovulation, oocyte maturation (particularly in women at a high risk of ovarian hyperstimulation syndrome), test for GnRH neuronal function, and gatekeepers of puberty onset. In addition, the kisspeptin analogs, such as TAK-448, showed promising agonistic activity in healthy women as well as in women with hypothalamic amenorrhoea or polycystic ovary syndrome. CONCLUSION: More clinical trials should focus on the therapeutic effect of kisspeptin, its receptor agonist and antagonist in women with reproductive disorders, such as hypothalamic amenorrhoea, polycystic ovary syndrome, and endometriosis. |
format | Online Article Text |
id | pubmed-9125910 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2022 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-91259102022-05-24 Advances in clinical applications of kisspeptin-GnRH pathway in female reproduction Hu, Kai-Lun Chen, Zimiao Li, Xiaoxue Cai, Enci Yang, Haiyan Chen, Yi Wang, Congying Ju, Liping Deng, Wenhai Mu, Liangshan Reprod Biol Endocrinol Review BACKGROUND: Kisspeptin is the leading upstream regulator of pulsatile and surge Gonadotrophin-Releasing Hormone secretion (GnRH) in the hypothalamus, which acts as the key governor of the hypothalamic-pituitary-ovary axis. MAIN TEXT: Exogenous kisspeptin or its receptor agonist can stimulate GnRH release and subsequent physiological gonadotropin secretion in humans. Based on the role of kisspeptin in the hypothalamus, a broad application of kisspeptin and its receptor agonist has been recently uncovered in humans, including central control of ovulation, oocyte maturation (particularly in women at a high risk of ovarian hyperstimulation syndrome), test for GnRH neuronal function, and gatekeepers of puberty onset. In addition, the kisspeptin analogs, such as TAK-448, showed promising agonistic activity in healthy women as well as in women with hypothalamic amenorrhoea or polycystic ovary syndrome. CONCLUSION: More clinical trials should focus on the therapeutic effect of kisspeptin, its receptor agonist and antagonist in women with reproductive disorders, such as hypothalamic amenorrhoea, polycystic ovary syndrome, and endometriosis. BioMed Central 2022-05-23 /pmc/articles/PMC9125910/ /pubmed/35606759 http://dx.doi.org/10.1186/s12958-022-00953-y Text en © The Author(s) 2022 https://creativecommons.org/licenses/by/4.0/Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data. |
spellingShingle | Review Hu, Kai-Lun Chen, Zimiao Li, Xiaoxue Cai, Enci Yang, Haiyan Chen, Yi Wang, Congying Ju, Liping Deng, Wenhai Mu, Liangshan Advances in clinical applications of kisspeptin-GnRH pathway in female reproduction |
title | Advances in clinical applications of kisspeptin-GnRH pathway in female reproduction |
title_full | Advances in clinical applications of kisspeptin-GnRH pathway in female reproduction |
title_fullStr | Advances in clinical applications of kisspeptin-GnRH pathway in female reproduction |
title_full_unstemmed | Advances in clinical applications of kisspeptin-GnRH pathway in female reproduction |
title_short | Advances in clinical applications of kisspeptin-GnRH pathway in female reproduction |
title_sort | advances in clinical applications of kisspeptin-gnrh pathway in female reproduction |
topic | Review |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9125910/ https://www.ncbi.nlm.nih.gov/pubmed/35606759 http://dx.doi.org/10.1186/s12958-022-00953-y |
work_keys_str_mv | AT hukailun advancesinclinicalapplicationsofkisspeptingnrhpathwayinfemalereproduction AT chenzimiao advancesinclinicalapplicationsofkisspeptingnrhpathwayinfemalereproduction AT lixiaoxue advancesinclinicalapplicationsofkisspeptingnrhpathwayinfemalereproduction AT caienci advancesinclinicalapplicationsofkisspeptingnrhpathwayinfemalereproduction AT yanghaiyan advancesinclinicalapplicationsofkisspeptingnrhpathwayinfemalereproduction AT chenyi advancesinclinicalapplicationsofkisspeptingnrhpathwayinfemalereproduction AT wangcongying advancesinclinicalapplicationsofkisspeptingnrhpathwayinfemalereproduction AT juliping advancesinclinicalapplicationsofkisspeptingnrhpathwayinfemalereproduction AT dengwenhai advancesinclinicalapplicationsofkisspeptingnrhpathwayinfemalereproduction AT muliangshan advancesinclinicalapplicationsofkisspeptingnrhpathwayinfemalereproduction |