Cargando…

Neurosyphilis in China: A Systematic Review of Cases From 2009–2021

Considered the increased threaten of neurosyphilis in China, a review on cases reported in the literature to describe the clinical epidemiological characteristics of neurosyphilis cases, may be beneficial to the early detection and management strategies of neurosyphilis for clinicians. We searched t...

Descripción completa

Detalles Bibliográficos
Autores principales: Du, Fang-Zhi, Zhang, Hai-Ni, Li, Jing-Jing, Zheng, Zhi-Ju, Zhang, Xu, Zhang, Rui-Li, Wang, Qian-Qiu
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Frontiers Media S.A. 2022
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9136070/
https://www.ncbi.nlm.nih.gov/pubmed/35646949
http://dx.doi.org/10.3389/fmed.2022.894841
_version_ 1784714095969173504
author Du, Fang-Zhi
Zhang, Hai-Ni
Li, Jing-Jing
Zheng, Zhi-Ju
Zhang, Xu
Zhang, Rui-Li
Wang, Qian-Qiu
author_facet Du, Fang-Zhi
Zhang, Hai-Ni
Li, Jing-Jing
Zheng, Zhi-Ju
Zhang, Xu
Zhang, Rui-Li
Wang, Qian-Qiu
author_sort Du, Fang-Zhi
collection PubMed
description Considered the increased threaten of neurosyphilis in China, a review on cases reported in the literature to describe the clinical epidemiological characteristics of neurosyphilis cases, may be beneficial to the early detection and management strategies of neurosyphilis for clinicians. We searched the literature on Chinese neurosyphilis cases published from January 1, 2009 to December 31, 2021, described their clinical epidemiological characteristics and calculated the prevalence of neurosyphilis amongst other associated diseases, according to the individual study criteria. A total of 284 studies including 7,486 neurosyphilis cases were included. No meta-analysis was performed due to the heterogeneity of the data. Among 149 case reports and 93 retrospective case series studies, the main clinical manifestation of 3,507 neurosyphilis cases was cerebral parenchymal syphilis (57.3%), followed by asymptomatic neurosyphilis (16.7%), meningovascular syphilis (13.6%), meningitis syphilis (7.7%) and ocular syphilis (2.8%), etc. In addition, the initial diagnosis was incorrect in 53.2% patients, and the most frequent misdiagnoses were mental disorders (31.0%), stroke (15.9%), cognitive impairment (9.0%), etc. The positive or abnormal rates of cerebrospinal fluid non-treponemal and treponemal tests, white blood cell counts and protein concentrations were 74.2%, 96.2%, 61.5%, and 60.9%, respectively. Aqueous penicillin was the first choice for treatment in 88.3% cases, and 81.7% and 50.0% patients had response in the improvement of symptoms and serological effective in CSF, respectively. Among 26 studies on neurosyphilis patients amongst other associated diseases, the prevalence of neurosyphilis amongst central nervous system infectious diseases, syphilis-associated neurological symptoms, serofast status, coinfected with human immunodeficiency virus were 10.6%–30.1%, 23.2%–35.5%, 9.8%–56.1%, and 8.9%, respectively. In summary, the lack of early detection of neurosyphilis cases remains a clinical challenge. The high rate of misdiagnosis and high prevalence of neurosyphilis amongst associated diseases strongly remind clinicians to focus on the early detection among suspected cases. Besides, the standard treatment regimen and long-term follow-up, which complied with guideline should be provided. Further prospective studies are urgent to better delineate the clinical epidemiological characteristics of neurosyphilis in China.
format Online
Article
Text
id pubmed-9136070
institution National Center for Biotechnology Information
language English
publishDate 2022
publisher Frontiers Media S.A.
record_format MEDLINE/PubMed
spelling pubmed-91360702022-05-28 Neurosyphilis in China: A Systematic Review of Cases From 2009–2021 Du, Fang-Zhi Zhang, Hai-Ni Li, Jing-Jing Zheng, Zhi-Ju Zhang, Xu Zhang, Rui-Li Wang, Qian-Qiu Front Med (Lausanne) Medicine Considered the increased threaten of neurosyphilis in China, a review on cases reported in the literature to describe the clinical epidemiological characteristics of neurosyphilis cases, may be beneficial to the early detection and management strategies of neurosyphilis for clinicians. We searched the literature on Chinese neurosyphilis cases published from January 1, 2009 to December 31, 2021, described their clinical epidemiological characteristics and calculated the prevalence of neurosyphilis amongst other associated diseases, according to the individual study criteria. A total of 284 studies including 7,486 neurosyphilis cases were included. No meta-analysis was performed due to the heterogeneity of the data. Among 149 case reports and 93 retrospective case series studies, the main clinical manifestation of 3,507 neurosyphilis cases was cerebral parenchymal syphilis (57.3%), followed by asymptomatic neurosyphilis (16.7%), meningovascular syphilis (13.6%), meningitis syphilis (7.7%) and ocular syphilis (2.8%), etc. In addition, the initial diagnosis was incorrect in 53.2% patients, and the most frequent misdiagnoses were mental disorders (31.0%), stroke (15.9%), cognitive impairment (9.0%), etc. The positive or abnormal rates of cerebrospinal fluid non-treponemal and treponemal tests, white blood cell counts and protein concentrations were 74.2%, 96.2%, 61.5%, and 60.9%, respectively. Aqueous penicillin was the first choice for treatment in 88.3% cases, and 81.7% and 50.0% patients had response in the improvement of symptoms and serological effective in CSF, respectively. Among 26 studies on neurosyphilis patients amongst other associated diseases, the prevalence of neurosyphilis amongst central nervous system infectious diseases, syphilis-associated neurological symptoms, serofast status, coinfected with human immunodeficiency virus were 10.6%–30.1%, 23.2%–35.5%, 9.8%–56.1%, and 8.9%, respectively. In summary, the lack of early detection of neurosyphilis cases remains a clinical challenge. The high rate of misdiagnosis and high prevalence of neurosyphilis amongst associated diseases strongly remind clinicians to focus on the early detection among suspected cases. Besides, the standard treatment regimen and long-term follow-up, which complied with guideline should be provided. Further prospective studies are urgent to better delineate the clinical epidemiological characteristics of neurosyphilis in China. Frontiers Media S.A. 2022-05-13 /pmc/articles/PMC9136070/ /pubmed/35646949 http://dx.doi.org/10.3389/fmed.2022.894841 Text en Copyright © 2022 Du, Zhang, Li, Zheng, Zhang, Zhang and Wang. https://creativecommons.org/licenses/by/4.0/This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) and the copyright owner(s) are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms.
spellingShingle Medicine
Du, Fang-Zhi
Zhang, Hai-Ni
Li, Jing-Jing
Zheng, Zhi-Ju
Zhang, Xu
Zhang, Rui-Li
Wang, Qian-Qiu
Neurosyphilis in China: A Systematic Review of Cases From 2009–2021
title Neurosyphilis in China: A Systematic Review of Cases From 2009–2021
title_full Neurosyphilis in China: A Systematic Review of Cases From 2009–2021
title_fullStr Neurosyphilis in China: A Systematic Review of Cases From 2009–2021
title_full_unstemmed Neurosyphilis in China: A Systematic Review of Cases From 2009–2021
title_short Neurosyphilis in China: A Systematic Review of Cases From 2009–2021
title_sort neurosyphilis in china: a systematic review of cases from 2009–2021
topic Medicine
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9136070/
https://www.ncbi.nlm.nih.gov/pubmed/35646949
http://dx.doi.org/10.3389/fmed.2022.894841
work_keys_str_mv AT dufangzhi neurosyphilisinchinaasystematicreviewofcasesfrom20092021
AT zhanghaini neurosyphilisinchinaasystematicreviewofcasesfrom20092021
AT lijingjing neurosyphilisinchinaasystematicreviewofcasesfrom20092021
AT zhengzhiju neurosyphilisinchinaasystematicreviewofcasesfrom20092021
AT zhangxu neurosyphilisinchinaasystematicreviewofcasesfrom20092021
AT zhangruili neurosyphilisinchinaasystematicreviewofcasesfrom20092021
AT wangqianqiu neurosyphilisinchinaasystematicreviewofcasesfrom20092021