Cargando…
Synthesis, X-ray diffraction analysis, quantum chemical studies and α-amylase inhibition of probenecid derived S-alkylphthalimide-oxadiazole-benzenesulfonamide hybrids
Sulphonamide and 1,3,4-oxadiazole moieties are present as integral structural parts of many drugs and pharmaceuticals. Taking into account the significance of these moieties, we herein present the synthesis, single-crystal X-ray analysis, DFT studies, and α-amylase inhibition of probenecid derived t...
Autores principales: | , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Taylor & Francis
2022
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9154803/ https://www.ncbi.nlm.nih.gov/pubmed/35616297 http://dx.doi.org/10.1080/14756366.2022.2078969 |
_version_ | 1784718108762570752 |
---|---|
author | Khan, Bilal Ahmad Hamdani, Syeda Shamila Ahmed, Muhammad Naeem Hameed, Shahid Ashfaq, Muhammad Shawky, Ahmed M. Ibrahim, Mahmoud A. A. Sidhom, Peter A. |
author_facet | Khan, Bilal Ahmad Hamdani, Syeda Shamila Ahmed, Muhammad Naeem Hameed, Shahid Ashfaq, Muhammad Shawky, Ahmed M. Ibrahim, Mahmoud A. A. Sidhom, Peter A. |
author_sort | Khan, Bilal Ahmad |
collection | PubMed |
description | Sulphonamide and 1,3,4-oxadiazole moieties are present as integral structural parts of many drugs and pharmaceuticals. Taking into account the significance of these moieties, we herein present the synthesis, single-crystal X-ray analysis, DFT studies, and α-amylase inhibition of probenecid derived two S-alkylphthalimide-oxadiazole-benzenesulfonamide hybrids. The synthesis has been accomplished in high yields. The final structures of both hybrids have been established completely with the help of different spectro-analytical techniques, including NMR, FTIR, HR-MS, and single-crystal X-ray diffraction analyses. In an effort to confirm the experimental findings, versatile quantum mechanical calculations and Hirshfeld Surface analysis have been performed. α-Amylase inhibition assay has been executed to investigate the enzyme inhibitory potential of both hybrids. The low IC(50) value (76.92 ± 0.19 μg/mL) of hybrid 2 shows the good α-amylase inhibition potential of the respective compound. Ultimately, the binding affinities and features of the two hybrids are elucidated utilising a molecular docking technique against the α-amylase enzyme. |
format | Online Article Text |
id | pubmed-9154803 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2022 |
publisher | Taylor & Francis |
record_format | MEDLINE/PubMed |
spelling | pubmed-91548032022-06-01 Synthesis, X-ray diffraction analysis, quantum chemical studies and α-amylase inhibition of probenecid derived S-alkylphthalimide-oxadiazole-benzenesulfonamide hybrids Khan, Bilal Ahmad Hamdani, Syeda Shamila Ahmed, Muhammad Naeem Hameed, Shahid Ashfaq, Muhammad Shawky, Ahmed M. Ibrahim, Mahmoud A. A. Sidhom, Peter A. J Enzyme Inhib Med Chem Research Papers Sulphonamide and 1,3,4-oxadiazole moieties are present as integral structural parts of many drugs and pharmaceuticals. Taking into account the significance of these moieties, we herein present the synthesis, single-crystal X-ray analysis, DFT studies, and α-amylase inhibition of probenecid derived two S-alkylphthalimide-oxadiazole-benzenesulfonamide hybrids. The synthesis has been accomplished in high yields. The final structures of both hybrids have been established completely with the help of different spectro-analytical techniques, including NMR, FTIR, HR-MS, and single-crystal X-ray diffraction analyses. In an effort to confirm the experimental findings, versatile quantum mechanical calculations and Hirshfeld Surface analysis have been performed. α-Amylase inhibition assay has been executed to investigate the enzyme inhibitory potential of both hybrids. The low IC(50) value (76.92 ± 0.19 μg/mL) of hybrid 2 shows the good α-amylase inhibition potential of the respective compound. Ultimately, the binding affinities and features of the two hybrids are elucidated utilising a molecular docking technique against the α-amylase enzyme. Taylor & Francis 2022-05-26 /pmc/articles/PMC9154803/ /pubmed/35616297 http://dx.doi.org/10.1080/14756366.2022.2078969 Text en © 2022 The Author(s). Published by Informa UK Limited, trading as Taylor & Francis Group. https://creativecommons.org/licenses/by/4.0/This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) ), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. |
spellingShingle | Research Papers Khan, Bilal Ahmad Hamdani, Syeda Shamila Ahmed, Muhammad Naeem Hameed, Shahid Ashfaq, Muhammad Shawky, Ahmed M. Ibrahim, Mahmoud A. A. Sidhom, Peter A. Synthesis, X-ray diffraction analysis, quantum chemical studies and α-amylase inhibition of probenecid derived S-alkylphthalimide-oxadiazole-benzenesulfonamide hybrids |
title | Synthesis, X-ray diffraction analysis, quantum chemical studies and α-amylase inhibition of probenecid derived S-alkylphthalimide-oxadiazole-benzenesulfonamide hybrids |
title_full | Synthesis, X-ray diffraction analysis, quantum chemical studies and α-amylase inhibition of probenecid derived S-alkylphthalimide-oxadiazole-benzenesulfonamide hybrids |
title_fullStr | Synthesis, X-ray diffraction analysis, quantum chemical studies and α-amylase inhibition of probenecid derived S-alkylphthalimide-oxadiazole-benzenesulfonamide hybrids |
title_full_unstemmed | Synthesis, X-ray diffraction analysis, quantum chemical studies and α-amylase inhibition of probenecid derived S-alkylphthalimide-oxadiazole-benzenesulfonamide hybrids |
title_short | Synthesis, X-ray diffraction analysis, quantum chemical studies and α-amylase inhibition of probenecid derived S-alkylphthalimide-oxadiazole-benzenesulfonamide hybrids |
title_sort | synthesis, x-ray diffraction analysis, quantum chemical studies and α-amylase inhibition of probenecid derived s-alkylphthalimide-oxadiazole-benzenesulfonamide hybrids |
topic | Research Papers |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9154803/ https://www.ncbi.nlm.nih.gov/pubmed/35616297 http://dx.doi.org/10.1080/14756366.2022.2078969 |
work_keys_str_mv | AT khanbilalahmad synthesisxraydiffractionanalysisquantumchemicalstudiesandaamylaseinhibitionofprobenecidderivedsalkylphthalimideoxadiazolebenzenesulfonamidehybrids AT hamdanisyedashamila synthesisxraydiffractionanalysisquantumchemicalstudiesandaamylaseinhibitionofprobenecidderivedsalkylphthalimideoxadiazolebenzenesulfonamidehybrids AT ahmedmuhammadnaeem synthesisxraydiffractionanalysisquantumchemicalstudiesandaamylaseinhibitionofprobenecidderivedsalkylphthalimideoxadiazolebenzenesulfonamidehybrids AT hameedshahid synthesisxraydiffractionanalysisquantumchemicalstudiesandaamylaseinhibitionofprobenecidderivedsalkylphthalimideoxadiazolebenzenesulfonamidehybrids AT ashfaqmuhammad synthesisxraydiffractionanalysisquantumchemicalstudiesandaamylaseinhibitionofprobenecidderivedsalkylphthalimideoxadiazolebenzenesulfonamidehybrids AT shawkyahmedm synthesisxraydiffractionanalysisquantumchemicalstudiesandaamylaseinhibitionofprobenecidderivedsalkylphthalimideoxadiazolebenzenesulfonamidehybrids AT ibrahimmahmoudaa synthesisxraydiffractionanalysisquantumchemicalstudiesandaamylaseinhibitionofprobenecidderivedsalkylphthalimideoxadiazolebenzenesulfonamidehybrids AT sidhompetera synthesisxraydiffractionanalysisquantumchemicalstudiesandaamylaseinhibitionofprobenecidderivedsalkylphthalimideoxadiazolebenzenesulfonamidehybrids |