Cargando…
Novel Homozygous CYP27B1 Gene Mutation in Vitamin D-Dependent Rickets Type 1A (VDDR1A) Disorder: A Case Report
BACKGROUND: Vitamin D-dependent rickets type 1A (VDDR1A) rickets is an uncommon kind of rickets that affects both boys and girls. Children with mutations are normal at birth and present at around 6 months to 2 years of age with symptoms. When suspected, genetic testing is required to confirm the dia...
Autores principales: | , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Frontiers Media S.A.
2022
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9157501/ https://www.ncbi.nlm.nih.gov/pubmed/35663328 http://dx.doi.org/10.3389/fendo.2022.862022 |
_version_ | 1784718651474051072 |
---|---|
author | Al Homyani, Doua Khalid Alhemaiani, Shahad Khalid |
author_facet | Al Homyani, Doua Khalid Alhemaiani, Shahad Khalid |
author_sort | Al Homyani, Doua Khalid |
collection | PubMed |
description | BACKGROUND: Vitamin D-dependent rickets type 1A (VDDR1A) rickets is an uncommon kind of rickets that affects both boys and girls. Children with mutations are normal at birth and present at around 6 months to 2 years of age with symptoms. When suspected, genetic testing is required to confirm the diagnosis CASE PRESENTATION: This is a case report of VDDR1A in a 4-year-old boy who presented with delayed growth, inability to stand, and rachitic bone deformities. The diagnosis was reached by anthropometric measurement, bone profile, and radiological studies, then confirmed by genetic testing, which revealed a homozygous pathogenic variant in the CYP27B1 gene. He was treated with Vitamin-D (alfacalcidol) and oral calcium. CONCLUSION: VDDR1A is caused by a mutation in the CYP27B1 gene, which impairs the 1 hydroxylase enzyme, which compromises vitamin-D production. |
format | Online Article Text |
id | pubmed-9157501 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2022 |
publisher | Frontiers Media S.A. |
record_format | MEDLINE/PubMed |
spelling | pubmed-91575012022-06-02 Novel Homozygous CYP27B1 Gene Mutation in Vitamin D-Dependent Rickets Type 1A (VDDR1A) Disorder: A Case Report Al Homyani, Doua Khalid Alhemaiani, Shahad Khalid Front Endocrinol (Lausanne) Endocrinology BACKGROUND: Vitamin D-dependent rickets type 1A (VDDR1A) rickets is an uncommon kind of rickets that affects both boys and girls. Children with mutations are normal at birth and present at around 6 months to 2 years of age with symptoms. When suspected, genetic testing is required to confirm the diagnosis CASE PRESENTATION: This is a case report of VDDR1A in a 4-year-old boy who presented with delayed growth, inability to stand, and rachitic bone deformities. The diagnosis was reached by anthropometric measurement, bone profile, and radiological studies, then confirmed by genetic testing, which revealed a homozygous pathogenic variant in the CYP27B1 gene. He was treated with Vitamin-D (alfacalcidol) and oral calcium. CONCLUSION: VDDR1A is caused by a mutation in the CYP27B1 gene, which impairs the 1 hydroxylase enzyme, which compromises vitamin-D production. Frontiers Media S.A. 2022-05-18 /pmc/articles/PMC9157501/ /pubmed/35663328 http://dx.doi.org/10.3389/fendo.2022.862022 Text en Copyright © 2022 Al Homyani and Alhemaiani https://creativecommons.org/licenses/by/4.0/This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) and the copyright owner(s) are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms. |
spellingShingle | Endocrinology Al Homyani, Doua Khalid Alhemaiani, Shahad Khalid Novel Homozygous CYP27B1 Gene Mutation in Vitamin D-Dependent Rickets Type 1A (VDDR1A) Disorder: A Case Report |
title | Novel Homozygous CYP27B1 Gene Mutation in Vitamin D-Dependent Rickets Type 1A (VDDR1A) Disorder: A Case Report |
title_full | Novel Homozygous CYP27B1 Gene Mutation in Vitamin D-Dependent Rickets Type 1A (VDDR1A) Disorder: A Case Report |
title_fullStr | Novel Homozygous CYP27B1 Gene Mutation in Vitamin D-Dependent Rickets Type 1A (VDDR1A) Disorder: A Case Report |
title_full_unstemmed | Novel Homozygous CYP27B1 Gene Mutation in Vitamin D-Dependent Rickets Type 1A (VDDR1A) Disorder: A Case Report |
title_short | Novel Homozygous CYP27B1 Gene Mutation in Vitamin D-Dependent Rickets Type 1A (VDDR1A) Disorder: A Case Report |
title_sort | novel homozygous cyp27b1 gene mutation in vitamin d-dependent rickets type 1a (vddr1a) disorder: a case report |
topic | Endocrinology |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9157501/ https://www.ncbi.nlm.nih.gov/pubmed/35663328 http://dx.doi.org/10.3389/fendo.2022.862022 |
work_keys_str_mv | AT alhomyanidouakhalid novelhomozygouscyp27b1genemutationinvitaminddependentricketstype1avddr1adisorderacasereport AT alhemaianishahadkhalid novelhomozygouscyp27b1genemutationinvitaminddependentricketstype1avddr1adisorderacasereport |