Cargando…

Novel Homozygous CYP27B1 Gene Mutation in Vitamin D-Dependent Rickets Type 1A (VDDR1A) Disorder: A Case Report

BACKGROUND: Vitamin D-dependent rickets type 1A (VDDR1A) rickets is an uncommon kind of rickets that affects both boys and girls. Children with mutations are normal at birth and present at around 6 months to 2 years of age with symptoms. When suspected, genetic testing is required to confirm the dia...

Descripción completa

Detalles Bibliográficos
Autores principales: Al Homyani, Doua Khalid, Alhemaiani, Shahad Khalid
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Frontiers Media S.A. 2022
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9157501/
https://www.ncbi.nlm.nih.gov/pubmed/35663328
http://dx.doi.org/10.3389/fendo.2022.862022
_version_ 1784718651474051072
author Al Homyani, Doua Khalid
Alhemaiani, Shahad Khalid
author_facet Al Homyani, Doua Khalid
Alhemaiani, Shahad Khalid
author_sort Al Homyani, Doua Khalid
collection PubMed
description BACKGROUND: Vitamin D-dependent rickets type 1A (VDDR1A) rickets is an uncommon kind of rickets that affects both boys and girls. Children with mutations are normal at birth and present at around 6 months to 2 years of age with symptoms. When suspected, genetic testing is required to confirm the diagnosis CASE PRESENTATION: This is a case report of VDDR1A in a 4-year-old boy who presented with delayed growth, inability to stand, and rachitic bone deformities. The diagnosis was reached by anthropometric measurement, bone profile, and radiological studies, then confirmed by genetic testing, which revealed a homozygous pathogenic variant in the CYP27B1 gene. He was treated with Vitamin-D (alfacalcidol) and oral calcium. CONCLUSION: VDDR1A is caused by a mutation in the CYP27B1 gene, which impairs the 1 hydroxylase enzyme, which compromises vitamin-D production.
format Online
Article
Text
id pubmed-9157501
institution National Center for Biotechnology Information
language English
publishDate 2022
publisher Frontiers Media S.A.
record_format MEDLINE/PubMed
spelling pubmed-91575012022-06-02 Novel Homozygous CYP27B1 Gene Mutation in Vitamin D-Dependent Rickets Type 1A (VDDR1A) Disorder: A Case Report Al Homyani, Doua Khalid Alhemaiani, Shahad Khalid Front Endocrinol (Lausanne) Endocrinology BACKGROUND: Vitamin D-dependent rickets type 1A (VDDR1A) rickets is an uncommon kind of rickets that affects both boys and girls. Children with mutations are normal at birth and present at around 6 months to 2 years of age with symptoms. When suspected, genetic testing is required to confirm the diagnosis CASE PRESENTATION: This is a case report of VDDR1A in a 4-year-old boy who presented with delayed growth, inability to stand, and rachitic bone deformities. The diagnosis was reached by anthropometric measurement, bone profile, and radiological studies, then confirmed by genetic testing, which revealed a homozygous pathogenic variant in the CYP27B1 gene. He was treated with Vitamin-D (alfacalcidol) and oral calcium. CONCLUSION: VDDR1A is caused by a mutation in the CYP27B1 gene, which impairs the 1 hydroxylase enzyme, which compromises vitamin-D production. Frontiers Media S.A. 2022-05-18 /pmc/articles/PMC9157501/ /pubmed/35663328 http://dx.doi.org/10.3389/fendo.2022.862022 Text en Copyright © 2022 Al Homyani and Alhemaiani https://creativecommons.org/licenses/by/4.0/This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) and the copyright owner(s) are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms.
spellingShingle Endocrinology
Al Homyani, Doua Khalid
Alhemaiani, Shahad Khalid
Novel Homozygous CYP27B1 Gene Mutation in Vitamin D-Dependent Rickets Type 1A (VDDR1A) Disorder: A Case Report
title Novel Homozygous CYP27B1 Gene Mutation in Vitamin D-Dependent Rickets Type 1A (VDDR1A) Disorder: A Case Report
title_full Novel Homozygous CYP27B1 Gene Mutation in Vitamin D-Dependent Rickets Type 1A (VDDR1A) Disorder: A Case Report
title_fullStr Novel Homozygous CYP27B1 Gene Mutation in Vitamin D-Dependent Rickets Type 1A (VDDR1A) Disorder: A Case Report
title_full_unstemmed Novel Homozygous CYP27B1 Gene Mutation in Vitamin D-Dependent Rickets Type 1A (VDDR1A) Disorder: A Case Report
title_short Novel Homozygous CYP27B1 Gene Mutation in Vitamin D-Dependent Rickets Type 1A (VDDR1A) Disorder: A Case Report
title_sort novel homozygous cyp27b1 gene mutation in vitamin d-dependent rickets type 1a (vddr1a) disorder: a case report
topic Endocrinology
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9157501/
https://www.ncbi.nlm.nih.gov/pubmed/35663328
http://dx.doi.org/10.3389/fendo.2022.862022
work_keys_str_mv AT alhomyanidouakhalid novelhomozygouscyp27b1genemutationinvitaminddependentricketstype1avddr1adisorderacasereport
AT alhemaianishahadkhalid novelhomozygouscyp27b1genemutationinvitaminddependentricketstype1avddr1adisorderacasereport