Cargando…

A Comparative Analysis of Microbe-Based Technologies Developed at ICAR-NBAIM Against Erysiphe necator Causing Powdery Mildew Disease in Grapes (Vitis vinifera L.)

Globally, Erysiphe necator causing powdery mildew disease in grapevines (Vitis vinifera L.) is the second most important endemic disease, causing huge economic losses every year. At present, the management of powdery mildew in grapes is largely dependent upon the use of chemical fungicides. Grapes a...

Descripción completa

Detalles Bibliográficos
Autores principales: Malviya, Deepti, Thosar, Ratna, Kokare, Namrata, Pawar, Shital, Singh, Udai B., Saha, Sujoy, Rai, Jai P., Singh, Harsh V., Somkuwar, R. G., Saxena, Anil K.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Frontiers Media S.A. 2022
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9159358/
https://www.ncbi.nlm.nih.gov/pubmed/35663883
http://dx.doi.org/10.3389/fmicb.2022.871901
_version_ 1784719038454169600
author Malviya, Deepti
Thosar, Ratna
Kokare, Namrata
Pawar, Shital
Singh, Udai B.
Saha, Sujoy
Rai, Jai P.
Singh, Harsh V.
Somkuwar, R. G.
Saxena, Anil K.
author_facet Malviya, Deepti
Thosar, Ratna
Kokare, Namrata
Pawar, Shital
Singh, Udai B.
Saha, Sujoy
Rai, Jai P.
Singh, Harsh V.
Somkuwar, R. G.
Saxena, Anil K.
author_sort Malviya, Deepti
collection PubMed
description Globally, Erysiphe necator causing powdery mildew disease in grapevines (Vitis vinifera L.) is the second most important endemic disease, causing huge economic losses every year. At present, the management of powdery mildew in grapes is largely dependent upon the use of chemical fungicides. Grapes are being considered as one of the high pesticide-demanding crops. Looking at the residual impact of toxic chemical pesticides on the environment, animal, and human health, microbe-based strategies for control of powdery mildew is an emerging technique. It offers an environment-friendly, residue-free, and effective yet safer approach to control powdery mildew disease in grapes. The mode of action is relatively diverse as well as specific to different pathosystems. Hence, the aim of this study was to evaluate the microbe-based technologies, i.e., Eco-pesticide(®), Bio-Pulse(®), and Bio-Care 24(®) developed at the Plant-Microbe Interaction and Rhizosphere Biology Lab, ICAR-NBAIM, Kushmaur, against grape powdery mildew and to integrate these technologies with a safer fungicide (sulfur) to achieve better disease control under organic systems of viticulture. The experiments were conducted at four different locations, namely, the vineyards of ICAR-NRCG, Rajya Draksha Bagayatdar Sangh (MRDBS), and two farmers' fields at Narayangaon and Junnar in the Pune district of Maharashtra. A significantly lower percent disease index (PDI) was recorded on the leaves of grape plants treated with Eco-Pesticide(®)/sulfur (22.37) followed by Bio-Pulse(®)/sulfur (22.62) and Bio-Care 24(®)/sulfur (24.62) at NRCG. A similar trend was observed with the lowest PDI on bunches of Eco-pesticide(®)/sulfur-treated plants (24.71) followed by Bio-Pulse(®)/sulfur (24.94) and Bio-Care(®)/sulfur (26.77). The application of microbial inoculants singly or in combination with sulfur has a significant positive impact on the qualitative parameters such as pH, total soluble solids (TSS), acidity, berry diameter, and berry length of the grapes at different locations. Among all the treatments, the Bio-Pulse(®)/sulfur treatment showed the highest yield per vine (15.02 kg), which was on par with the treatment Eco-Pesticide(®)/sulfur (14.94). When compared with the yield obtained from the untreated control, 2.5 to 3 times more yield was recorded in the plants treated with either of the biopesticides used in combination with sulfur. Even in the case of individual inoculation, the yield per vine was approximately two times higher than the untreated control and water-treated plants across the test locations. Results suggested that microbial technologies not only protect grapevines from powdery mildew but also enhance the quality parameters with increased yield across the test locations.
format Online
Article
Text
id pubmed-9159358
institution National Center for Biotechnology Information
language English
publishDate 2022
publisher Frontiers Media S.A.
record_format MEDLINE/PubMed
spelling pubmed-91593582022-06-02 A Comparative Analysis of Microbe-Based Technologies Developed at ICAR-NBAIM Against Erysiphe necator Causing Powdery Mildew Disease in Grapes (Vitis vinifera L.) Malviya, Deepti Thosar, Ratna Kokare, Namrata Pawar, Shital Singh, Udai B. Saha, Sujoy Rai, Jai P. Singh, Harsh V. Somkuwar, R. G. Saxena, Anil K. Front Microbiol Microbiology Globally, Erysiphe necator causing powdery mildew disease in grapevines (Vitis vinifera L.) is the second most important endemic disease, causing huge economic losses every year. At present, the management of powdery mildew in grapes is largely dependent upon the use of chemical fungicides. Grapes are being considered as one of the high pesticide-demanding crops. Looking at the residual impact of toxic chemical pesticides on the environment, animal, and human health, microbe-based strategies for control of powdery mildew is an emerging technique. It offers an environment-friendly, residue-free, and effective yet safer approach to control powdery mildew disease in grapes. The mode of action is relatively diverse as well as specific to different pathosystems. Hence, the aim of this study was to evaluate the microbe-based technologies, i.e., Eco-pesticide(®), Bio-Pulse(®), and Bio-Care 24(®) developed at the Plant-Microbe Interaction and Rhizosphere Biology Lab, ICAR-NBAIM, Kushmaur, against grape powdery mildew and to integrate these technologies with a safer fungicide (sulfur) to achieve better disease control under organic systems of viticulture. The experiments were conducted at four different locations, namely, the vineyards of ICAR-NRCG, Rajya Draksha Bagayatdar Sangh (MRDBS), and two farmers' fields at Narayangaon and Junnar in the Pune district of Maharashtra. A significantly lower percent disease index (PDI) was recorded on the leaves of grape plants treated with Eco-Pesticide(®)/sulfur (22.37) followed by Bio-Pulse(®)/sulfur (22.62) and Bio-Care 24(®)/sulfur (24.62) at NRCG. A similar trend was observed with the lowest PDI on bunches of Eco-pesticide(®)/sulfur-treated plants (24.71) followed by Bio-Pulse(®)/sulfur (24.94) and Bio-Care(®)/sulfur (26.77). The application of microbial inoculants singly or in combination with sulfur has a significant positive impact on the qualitative parameters such as pH, total soluble solids (TSS), acidity, berry diameter, and berry length of the grapes at different locations. Among all the treatments, the Bio-Pulse(®)/sulfur treatment showed the highest yield per vine (15.02 kg), which was on par with the treatment Eco-Pesticide(®)/sulfur (14.94). When compared with the yield obtained from the untreated control, 2.5 to 3 times more yield was recorded in the plants treated with either of the biopesticides used in combination with sulfur. Even in the case of individual inoculation, the yield per vine was approximately two times higher than the untreated control and water-treated plants across the test locations. Results suggested that microbial technologies not only protect grapevines from powdery mildew but also enhance the quality parameters with increased yield across the test locations. Frontiers Media S.A. 2022-05-17 /pmc/articles/PMC9159358/ /pubmed/35663883 http://dx.doi.org/10.3389/fmicb.2022.871901 Text en Copyright © 2022 Malviya, Thosar, Kokare, Pawar, Singh, Saha, Rai, Singh, Somkuwar and Saxena. https://creativecommons.org/licenses/by/4.0/This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) and the copyright owner(s) are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms.
spellingShingle Microbiology
Malviya, Deepti
Thosar, Ratna
Kokare, Namrata
Pawar, Shital
Singh, Udai B.
Saha, Sujoy
Rai, Jai P.
Singh, Harsh V.
Somkuwar, R. G.
Saxena, Anil K.
A Comparative Analysis of Microbe-Based Technologies Developed at ICAR-NBAIM Against Erysiphe necator Causing Powdery Mildew Disease in Grapes (Vitis vinifera L.)
title A Comparative Analysis of Microbe-Based Technologies Developed at ICAR-NBAIM Against Erysiphe necator Causing Powdery Mildew Disease in Grapes (Vitis vinifera L.)
title_full A Comparative Analysis of Microbe-Based Technologies Developed at ICAR-NBAIM Against Erysiphe necator Causing Powdery Mildew Disease in Grapes (Vitis vinifera L.)
title_fullStr A Comparative Analysis of Microbe-Based Technologies Developed at ICAR-NBAIM Against Erysiphe necator Causing Powdery Mildew Disease in Grapes (Vitis vinifera L.)
title_full_unstemmed A Comparative Analysis of Microbe-Based Technologies Developed at ICAR-NBAIM Against Erysiphe necator Causing Powdery Mildew Disease in Grapes (Vitis vinifera L.)
title_short A Comparative Analysis of Microbe-Based Technologies Developed at ICAR-NBAIM Against Erysiphe necator Causing Powdery Mildew Disease in Grapes (Vitis vinifera L.)
title_sort comparative analysis of microbe-based technologies developed at icar-nbaim against erysiphe necator causing powdery mildew disease in grapes (vitis vinifera l.)
topic Microbiology
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9159358/
https://www.ncbi.nlm.nih.gov/pubmed/35663883
http://dx.doi.org/10.3389/fmicb.2022.871901
work_keys_str_mv AT malviyadeepti acomparativeanalysisofmicrobebasedtechnologiesdevelopedaticarnbaimagainsterysiphenecatorcausingpowderymildewdiseaseingrapesvitisviniferal
AT thosarratna acomparativeanalysisofmicrobebasedtechnologiesdevelopedaticarnbaimagainsterysiphenecatorcausingpowderymildewdiseaseingrapesvitisviniferal
AT kokarenamrata acomparativeanalysisofmicrobebasedtechnologiesdevelopedaticarnbaimagainsterysiphenecatorcausingpowderymildewdiseaseingrapesvitisviniferal
AT pawarshital acomparativeanalysisofmicrobebasedtechnologiesdevelopedaticarnbaimagainsterysiphenecatorcausingpowderymildewdiseaseingrapesvitisviniferal
AT singhudaib acomparativeanalysisofmicrobebasedtechnologiesdevelopedaticarnbaimagainsterysiphenecatorcausingpowderymildewdiseaseingrapesvitisviniferal
AT sahasujoy acomparativeanalysisofmicrobebasedtechnologiesdevelopedaticarnbaimagainsterysiphenecatorcausingpowderymildewdiseaseingrapesvitisviniferal
AT raijaip acomparativeanalysisofmicrobebasedtechnologiesdevelopedaticarnbaimagainsterysiphenecatorcausingpowderymildewdiseaseingrapesvitisviniferal
AT singhharshv acomparativeanalysisofmicrobebasedtechnologiesdevelopedaticarnbaimagainsterysiphenecatorcausingpowderymildewdiseaseingrapesvitisviniferal
AT somkuwarrg acomparativeanalysisofmicrobebasedtechnologiesdevelopedaticarnbaimagainsterysiphenecatorcausingpowderymildewdiseaseingrapesvitisviniferal
AT saxenaanilk acomparativeanalysisofmicrobebasedtechnologiesdevelopedaticarnbaimagainsterysiphenecatorcausingpowderymildewdiseaseingrapesvitisviniferal
AT malviyadeepti comparativeanalysisofmicrobebasedtechnologiesdevelopedaticarnbaimagainsterysiphenecatorcausingpowderymildewdiseaseingrapesvitisviniferal
AT thosarratna comparativeanalysisofmicrobebasedtechnologiesdevelopedaticarnbaimagainsterysiphenecatorcausingpowderymildewdiseaseingrapesvitisviniferal
AT kokarenamrata comparativeanalysisofmicrobebasedtechnologiesdevelopedaticarnbaimagainsterysiphenecatorcausingpowderymildewdiseaseingrapesvitisviniferal
AT pawarshital comparativeanalysisofmicrobebasedtechnologiesdevelopedaticarnbaimagainsterysiphenecatorcausingpowderymildewdiseaseingrapesvitisviniferal
AT singhudaib comparativeanalysisofmicrobebasedtechnologiesdevelopedaticarnbaimagainsterysiphenecatorcausingpowderymildewdiseaseingrapesvitisviniferal
AT sahasujoy comparativeanalysisofmicrobebasedtechnologiesdevelopedaticarnbaimagainsterysiphenecatorcausingpowderymildewdiseaseingrapesvitisviniferal
AT raijaip comparativeanalysisofmicrobebasedtechnologiesdevelopedaticarnbaimagainsterysiphenecatorcausingpowderymildewdiseaseingrapesvitisviniferal
AT singhharshv comparativeanalysisofmicrobebasedtechnologiesdevelopedaticarnbaimagainsterysiphenecatorcausingpowderymildewdiseaseingrapesvitisviniferal
AT somkuwarrg comparativeanalysisofmicrobebasedtechnologiesdevelopedaticarnbaimagainsterysiphenecatorcausingpowderymildewdiseaseingrapesvitisviniferal
AT saxenaanilk comparativeanalysisofmicrobebasedtechnologiesdevelopedaticarnbaimagainsterysiphenecatorcausingpowderymildewdiseaseingrapesvitisviniferal