Cargando…
LGG-25. The first-in-class ERK inhibitor ulixertinib (BVD-523) shows activity in MAPK-driven pediatric low-grade glioma models as single agent and in combination with MEK inhibitors or senolytics
Ulixertinib (BVD-523) is a catalytic ERK1/2 inhibitor that showed promising responses in adult patients with mitogen-activated protein kinase (MAPK)-driven solid tumors. Pediatric low-grade gliomas (pLGG) are the most common pediatric brain tumors, with the most frequent driving alterations in the M...
Autores principales: | , , , , , , , , , , , , , , , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Oxford University Press
2022
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9164732/ http://dx.doi.org/10.1093/neuonc/noac079.339 |
_version_ | 1784720205829636096 |
---|---|
author | Sigaud, Romain Rösch, Lisa Gatzweiler, Charlotte Benzel, Julia von Soosten, Laura Peterziel, Heike Najafi, Sara Ayhan, Simay Gerloff, Xena F Hofmann, Nina Büdenbender, Isabel Foerster, Kathrin I Burhenne, Jürgen Longuespée, Rémi van Tilburg, Cornelis M Jones, David T W Pfister, Stefan M Knoerzer, Deborah Kreider, Brent Sauter, Max Pajtler, Kristian W Zuckermann, Marc Oehme, Ina Witt, Olaf Milde, Till |
author_facet | Sigaud, Romain Rösch, Lisa Gatzweiler, Charlotte Benzel, Julia von Soosten, Laura Peterziel, Heike Najafi, Sara Ayhan, Simay Gerloff, Xena F Hofmann, Nina Büdenbender, Isabel Foerster, Kathrin I Burhenne, Jürgen Longuespée, Rémi van Tilburg, Cornelis M Jones, David T W Pfister, Stefan M Knoerzer, Deborah Kreider, Brent Sauter, Max Pajtler, Kristian W Zuckermann, Marc Oehme, Ina Witt, Olaf Milde, Till |
author_sort | Sigaud, Romain |
collection | PubMed |
description | Ulixertinib (BVD-523) is a catalytic ERK1/2 inhibitor that showed promising responses in adult patients with mitogen-activated protein kinase (MAPK)-driven solid tumors. Pediatric low-grade gliomas (pLGG) are the most common pediatric brain tumors, with the most frequent driving alterations in the MAPK pathway. The anti-tumor activity of ulixertinib in pLGG and its potential synergism in combination with MEK inhibitors, senolytics, and chemotherapy were investigated in vitro using metabolic activity, MAPK reporter assay and high-content microscopy in pLGG-derived cell lines (DKFZ-BT66 - KIAA:BRAF fusion; BT40 - BRAF V600E mutation and CDKN2A/B deletion). The most clinically relevant combinations were further validated in vivo: 1) in zebrafish embryo models (BT40 and DKFZ-BT66 yolk sac injection) and 2) in NSG mice (BT40 orthotopic PDX) including in vivo pharmacokinetic and -dynamic analyses. Ulixertinib inhibited MAPK pathway activity in all models and reduced cell viability in the BRAF V600E mutated cell line at concentrations in the nanomolar range. In vivo pharmacokinetic and -dynamic analyses showed penetrance of the drug into mouse brain tissue and on-target activity, with concentrations above the in vitro IC50 and reduction of MAPK activity. Ulixertinib treatment slowed tumor growth and significantly increased survival in NSG mice with BT40 xenografts. Ulixertinib showed indications for anti-proliferative synergy in vitro in combination with MEK inhibitors (trametinib, binimetinib) or BH3 mimetics (navitoclax, A-1331852). Combinations with chemotherapy (carboplatin, vinblastine) were at most additive. Indications for synergy with binimetinib and navitoclax were confirmed in the zebrafish embryo models. In the NSG mouse model, the combination of ulixertinib with senolytics induced effects on tumor growth and survival comparable to ulixertinib monotherapy. Ulixertinib shows promising potential as a clinically relevant therapeutic option for the treatment of pLGG to be further investigated in upcoming clinical trials. Potential synergism with MEK inhibitors and BH3 mimetics was noted and warrants further investigation. |
format | Online Article Text |
id | pubmed-9164732 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2022 |
publisher | Oxford University Press |
record_format | MEDLINE/PubMed |
spelling | pubmed-91647322022-06-05 LGG-25. The first-in-class ERK inhibitor ulixertinib (BVD-523) shows activity in MAPK-driven pediatric low-grade glioma models as single agent and in combination with MEK inhibitors or senolytics Sigaud, Romain Rösch, Lisa Gatzweiler, Charlotte Benzel, Julia von Soosten, Laura Peterziel, Heike Najafi, Sara Ayhan, Simay Gerloff, Xena F Hofmann, Nina Büdenbender, Isabel Foerster, Kathrin I Burhenne, Jürgen Longuespée, Rémi van Tilburg, Cornelis M Jones, David T W Pfister, Stefan M Knoerzer, Deborah Kreider, Brent Sauter, Max Pajtler, Kristian W Zuckermann, Marc Oehme, Ina Witt, Olaf Milde, Till Neuro Oncol Low Grade Glioma Ulixertinib (BVD-523) is a catalytic ERK1/2 inhibitor that showed promising responses in adult patients with mitogen-activated protein kinase (MAPK)-driven solid tumors. Pediatric low-grade gliomas (pLGG) are the most common pediatric brain tumors, with the most frequent driving alterations in the MAPK pathway. The anti-tumor activity of ulixertinib in pLGG and its potential synergism in combination with MEK inhibitors, senolytics, and chemotherapy were investigated in vitro using metabolic activity, MAPK reporter assay and high-content microscopy in pLGG-derived cell lines (DKFZ-BT66 - KIAA:BRAF fusion; BT40 - BRAF V600E mutation and CDKN2A/B deletion). The most clinically relevant combinations were further validated in vivo: 1) in zebrafish embryo models (BT40 and DKFZ-BT66 yolk sac injection) and 2) in NSG mice (BT40 orthotopic PDX) including in vivo pharmacokinetic and -dynamic analyses. Ulixertinib inhibited MAPK pathway activity in all models and reduced cell viability in the BRAF V600E mutated cell line at concentrations in the nanomolar range. In vivo pharmacokinetic and -dynamic analyses showed penetrance of the drug into mouse brain tissue and on-target activity, with concentrations above the in vitro IC50 and reduction of MAPK activity. Ulixertinib treatment slowed tumor growth and significantly increased survival in NSG mice with BT40 xenografts. Ulixertinib showed indications for anti-proliferative synergy in vitro in combination with MEK inhibitors (trametinib, binimetinib) or BH3 mimetics (navitoclax, A-1331852). Combinations with chemotherapy (carboplatin, vinblastine) were at most additive. Indications for synergy with binimetinib and navitoclax were confirmed in the zebrafish embryo models. In the NSG mouse model, the combination of ulixertinib with senolytics induced effects on tumor growth and survival comparable to ulixertinib monotherapy. Ulixertinib shows promising potential as a clinically relevant therapeutic option for the treatment of pLGG to be further investigated in upcoming clinical trials. Potential synergism with MEK inhibitors and BH3 mimetics was noted and warrants further investigation. Oxford University Press 2022-06-03 /pmc/articles/PMC9164732/ http://dx.doi.org/10.1093/neuonc/noac079.339 Text en © The Author(s) 2022. Published by Oxford University Press on behalf of the Society for Neuro-Oncology. https://creativecommons.org/licenses/by-nc/4.0/This is an Open Access article distributed under the terms of the Creative Commons Attribution-NonCommercial License (https://creativecommons.org/licenses/by-nc/4.0/), which permits non-commercial re-use, distribution, and reproduction in any medium, provided the original work is properly cited. For commercial re-use, please contact journals.permissions@oup.com |
spellingShingle | Low Grade Glioma Sigaud, Romain Rösch, Lisa Gatzweiler, Charlotte Benzel, Julia von Soosten, Laura Peterziel, Heike Najafi, Sara Ayhan, Simay Gerloff, Xena F Hofmann, Nina Büdenbender, Isabel Foerster, Kathrin I Burhenne, Jürgen Longuespée, Rémi van Tilburg, Cornelis M Jones, David T W Pfister, Stefan M Knoerzer, Deborah Kreider, Brent Sauter, Max Pajtler, Kristian W Zuckermann, Marc Oehme, Ina Witt, Olaf Milde, Till LGG-25. The first-in-class ERK inhibitor ulixertinib (BVD-523) shows activity in MAPK-driven pediatric low-grade glioma models as single agent and in combination with MEK inhibitors or senolytics |
title | LGG-25. The first-in-class ERK inhibitor ulixertinib (BVD-523) shows activity in MAPK-driven pediatric low-grade glioma models as single agent and in combination with MEK inhibitors or senolytics |
title_full | LGG-25. The first-in-class ERK inhibitor ulixertinib (BVD-523) shows activity in MAPK-driven pediatric low-grade glioma models as single agent and in combination with MEK inhibitors or senolytics |
title_fullStr | LGG-25. The first-in-class ERK inhibitor ulixertinib (BVD-523) shows activity in MAPK-driven pediatric low-grade glioma models as single agent and in combination with MEK inhibitors or senolytics |
title_full_unstemmed | LGG-25. The first-in-class ERK inhibitor ulixertinib (BVD-523) shows activity in MAPK-driven pediatric low-grade glioma models as single agent and in combination with MEK inhibitors or senolytics |
title_short | LGG-25. The first-in-class ERK inhibitor ulixertinib (BVD-523) shows activity in MAPK-driven pediatric low-grade glioma models as single agent and in combination with MEK inhibitors or senolytics |
title_sort | lgg-25. the first-in-class erk inhibitor ulixertinib (bvd-523) shows activity in mapk-driven pediatric low-grade glioma models as single agent and in combination with mek inhibitors or senolytics |
topic | Low Grade Glioma |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9164732/ http://dx.doi.org/10.1093/neuonc/noac079.339 |
work_keys_str_mv | AT sigaudromain lgg25thefirstinclasserkinhibitorulixertinibbvd523showsactivityinmapkdrivenpediatriclowgradegliomamodelsassingleagentandincombinationwithmekinhibitorsorsenolytics AT roschlisa lgg25thefirstinclasserkinhibitorulixertinibbvd523showsactivityinmapkdrivenpediatriclowgradegliomamodelsassingleagentandincombinationwithmekinhibitorsorsenolytics AT gatzweilercharlotte lgg25thefirstinclasserkinhibitorulixertinibbvd523showsactivityinmapkdrivenpediatriclowgradegliomamodelsassingleagentandincombinationwithmekinhibitorsorsenolytics AT benzeljulia lgg25thefirstinclasserkinhibitorulixertinibbvd523showsactivityinmapkdrivenpediatriclowgradegliomamodelsassingleagentandincombinationwithmekinhibitorsorsenolytics AT vonsoostenlaura lgg25thefirstinclasserkinhibitorulixertinibbvd523showsactivityinmapkdrivenpediatriclowgradegliomamodelsassingleagentandincombinationwithmekinhibitorsorsenolytics AT peterzielheike lgg25thefirstinclasserkinhibitorulixertinibbvd523showsactivityinmapkdrivenpediatriclowgradegliomamodelsassingleagentandincombinationwithmekinhibitorsorsenolytics AT najafisara lgg25thefirstinclasserkinhibitorulixertinibbvd523showsactivityinmapkdrivenpediatriclowgradegliomamodelsassingleagentandincombinationwithmekinhibitorsorsenolytics AT ayhansimay lgg25thefirstinclasserkinhibitorulixertinibbvd523showsactivityinmapkdrivenpediatriclowgradegliomamodelsassingleagentandincombinationwithmekinhibitorsorsenolytics AT gerloffxenaf lgg25thefirstinclasserkinhibitorulixertinibbvd523showsactivityinmapkdrivenpediatriclowgradegliomamodelsassingleagentandincombinationwithmekinhibitorsorsenolytics AT hofmannnina lgg25thefirstinclasserkinhibitorulixertinibbvd523showsactivityinmapkdrivenpediatriclowgradegliomamodelsassingleagentandincombinationwithmekinhibitorsorsenolytics AT budenbenderisabel lgg25thefirstinclasserkinhibitorulixertinibbvd523showsactivityinmapkdrivenpediatriclowgradegliomamodelsassingleagentandincombinationwithmekinhibitorsorsenolytics AT foersterkathrini lgg25thefirstinclasserkinhibitorulixertinibbvd523showsactivityinmapkdrivenpediatriclowgradegliomamodelsassingleagentandincombinationwithmekinhibitorsorsenolytics AT burhennejurgen lgg25thefirstinclasserkinhibitorulixertinibbvd523showsactivityinmapkdrivenpediatriclowgradegliomamodelsassingleagentandincombinationwithmekinhibitorsorsenolytics AT longuespeeremi lgg25thefirstinclasserkinhibitorulixertinibbvd523showsactivityinmapkdrivenpediatriclowgradegliomamodelsassingleagentandincombinationwithmekinhibitorsorsenolytics AT vantilburgcornelism lgg25thefirstinclasserkinhibitorulixertinibbvd523showsactivityinmapkdrivenpediatriclowgradegliomamodelsassingleagentandincombinationwithmekinhibitorsorsenolytics AT jonesdavidtw lgg25thefirstinclasserkinhibitorulixertinibbvd523showsactivityinmapkdrivenpediatriclowgradegliomamodelsassingleagentandincombinationwithmekinhibitorsorsenolytics AT pfisterstefanm lgg25thefirstinclasserkinhibitorulixertinibbvd523showsactivityinmapkdrivenpediatriclowgradegliomamodelsassingleagentandincombinationwithmekinhibitorsorsenolytics AT knoerzerdeborah lgg25thefirstinclasserkinhibitorulixertinibbvd523showsactivityinmapkdrivenpediatriclowgradegliomamodelsassingleagentandincombinationwithmekinhibitorsorsenolytics AT kreiderbrent lgg25thefirstinclasserkinhibitorulixertinibbvd523showsactivityinmapkdrivenpediatriclowgradegliomamodelsassingleagentandincombinationwithmekinhibitorsorsenolytics AT sautermax lgg25thefirstinclasserkinhibitorulixertinibbvd523showsactivityinmapkdrivenpediatriclowgradegliomamodelsassingleagentandincombinationwithmekinhibitorsorsenolytics AT pajtlerkristianw lgg25thefirstinclasserkinhibitorulixertinibbvd523showsactivityinmapkdrivenpediatriclowgradegliomamodelsassingleagentandincombinationwithmekinhibitorsorsenolytics AT zuckermannmarc lgg25thefirstinclasserkinhibitorulixertinibbvd523showsactivityinmapkdrivenpediatriclowgradegliomamodelsassingleagentandincombinationwithmekinhibitorsorsenolytics AT oehmeina lgg25thefirstinclasserkinhibitorulixertinibbvd523showsactivityinmapkdrivenpediatriclowgradegliomamodelsassingleagentandincombinationwithmekinhibitorsorsenolytics AT wittolaf lgg25thefirstinclasserkinhibitorulixertinibbvd523showsactivityinmapkdrivenpediatriclowgradegliomamodelsassingleagentandincombinationwithmekinhibitorsorsenolytics AT mildetill lgg25thefirstinclasserkinhibitorulixertinibbvd523showsactivityinmapkdrivenpediatriclowgradegliomamodelsassingleagentandincombinationwithmekinhibitorsorsenolytics |