Cargando…

LGG-25. The first-in-class ERK inhibitor ulixertinib (BVD-523) shows activity in MAPK-driven pediatric low-grade glioma models as single agent and in combination with MEK inhibitors or senolytics

Ulixertinib (BVD-523) is a catalytic ERK1/2 inhibitor that showed promising responses in adult patients with mitogen-activated protein kinase (MAPK)-driven solid tumors. Pediatric low-grade gliomas (pLGG) are the most common pediatric brain tumors, with the most frequent driving alterations in the M...

Descripción completa

Detalles Bibliográficos
Autores principales: Sigaud, Romain, Rösch, Lisa, Gatzweiler, Charlotte, Benzel, Julia, von Soosten, Laura, Peterziel, Heike, Najafi, Sara, Ayhan, Simay, Gerloff, Xena F, Hofmann, Nina, Büdenbender, Isabel, Foerster, Kathrin I, Burhenne, Jürgen, Longuespée, Rémi, van Tilburg, Cornelis M, Jones, David T W, Pfister, Stefan M, Knoerzer, Deborah, Kreider, Brent, Sauter, Max, Pajtler, Kristian W, Zuckermann, Marc, Oehme, Ina, Witt, Olaf, Milde, Till
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Oxford University Press 2022
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9164732/
http://dx.doi.org/10.1093/neuonc/noac079.339
_version_ 1784720205829636096
author Sigaud, Romain
Rösch, Lisa
Gatzweiler, Charlotte
Benzel, Julia
von Soosten, Laura
Peterziel, Heike
Najafi, Sara
Ayhan, Simay
Gerloff, Xena F
Hofmann, Nina
Büdenbender, Isabel
Foerster, Kathrin I
Burhenne, Jürgen
Longuespée, Rémi
van Tilburg, Cornelis M
Jones, David T W
Pfister, Stefan M
Knoerzer, Deborah
Kreider, Brent
Sauter, Max
Pajtler, Kristian W
Zuckermann, Marc
Oehme, Ina
Witt, Olaf
Milde, Till
author_facet Sigaud, Romain
Rösch, Lisa
Gatzweiler, Charlotte
Benzel, Julia
von Soosten, Laura
Peterziel, Heike
Najafi, Sara
Ayhan, Simay
Gerloff, Xena F
Hofmann, Nina
Büdenbender, Isabel
Foerster, Kathrin I
Burhenne, Jürgen
Longuespée, Rémi
van Tilburg, Cornelis M
Jones, David T W
Pfister, Stefan M
Knoerzer, Deborah
Kreider, Brent
Sauter, Max
Pajtler, Kristian W
Zuckermann, Marc
Oehme, Ina
Witt, Olaf
Milde, Till
author_sort Sigaud, Romain
collection PubMed
description Ulixertinib (BVD-523) is a catalytic ERK1/2 inhibitor that showed promising responses in adult patients with mitogen-activated protein kinase (MAPK)-driven solid tumors. Pediatric low-grade gliomas (pLGG) are the most common pediatric brain tumors, with the most frequent driving alterations in the MAPK pathway. The anti-tumor activity of ulixertinib in pLGG and its potential synergism in combination with MEK inhibitors, senolytics, and chemotherapy were investigated in vitro using metabolic activity, MAPK reporter assay and high-content microscopy in pLGG-derived cell lines (DKFZ-BT66 - KIAA:BRAF fusion; BT40 - BRAF V600E mutation and CDKN2A/B deletion). The most clinically relevant combinations were further validated in vivo: 1) in zebrafish embryo models (BT40 and DKFZ-BT66 yolk sac injection) and 2) in NSG mice (BT40 orthotopic PDX) including in vivo pharmacokinetic and -dynamic analyses. Ulixertinib inhibited MAPK pathway activity in all models and reduced cell viability in the BRAF V600E mutated cell line at concentrations in the nanomolar range. In vivo pharmacokinetic and -dynamic analyses showed penetrance of the drug into mouse brain tissue and on-target activity, with concentrations above the in vitro IC50 and reduction of MAPK activity. Ulixertinib treatment slowed tumor growth and significantly increased survival in NSG mice with BT40 xenografts. Ulixertinib showed indications for anti-proliferative synergy in vitro in combination with MEK inhibitors (trametinib, binimetinib) or BH3 mimetics (navitoclax, A-1331852). Combinations with chemotherapy (carboplatin, vinblastine) were at most additive. Indications for synergy with binimetinib and navitoclax were confirmed in the zebrafish embryo models. In the NSG mouse model, the combination of ulixertinib with senolytics induced effects on tumor growth and survival comparable to ulixertinib monotherapy. Ulixertinib shows promising potential as a clinically relevant therapeutic option for the treatment of pLGG to be further investigated in upcoming clinical trials. Potential synergism with MEK inhibitors and BH3 mimetics was noted and warrants further investigation.
format Online
Article
Text
id pubmed-9164732
institution National Center for Biotechnology Information
language English
publishDate 2022
publisher Oxford University Press
record_format MEDLINE/PubMed
spelling pubmed-91647322022-06-05 LGG-25. The first-in-class ERK inhibitor ulixertinib (BVD-523) shows activity in MAPK-driven pediatric low-grade glioma models as single agent and in combination with MEK inhibitors or senolytics Sigaud, Romain Rösch, Lisa Gatzweiler, Charlotte Benzel, Julia von Soosten, Laura Peterziel, Heike Najafi, Sara Ayhan, Simay Gerloff, Xena F Hofmann, Nina Büdenbender, Isabel Foerster, Kathrin I Burhenne, Jürgen Longuespée, Rémi van Tilburg, Cornelis M Jones, David T W Pfister, Stefan M Knoerzer, Deborah Kreider, Brent Sauter, Max Pajtler, Kristian W Zuckermann, Marc Oehme, Ina Witt, Olaf Milde, Till Neuro Oncol Low Grade Glioma Ulixertinib (BVD-523) is a catalytic ERK1/2 inhibitor that showed promising responses in adult patients with mitogen-activated protein kinase (MAPK)-driven solid tumors. Pediatric low-grade gliomas (pLGG) are the most common pediatric brain tumors, with the most frequent driving alterations in the MAPK pathway. The anti-tumor activity of ulixertinib in pLGG and its potential synergism in combination with MEK inhibitors, senolytics, and chemotherapy were investigated in vitro using metabolic activity, MAPK reporter assay and high-content microscopy in pLGG-derived cell lines (DKFZ-BT66 - KIAA:BRAF fusion; BT40 - BRAF V600E mutation and CDKN2A/B deletion). The most clinically relevant combinations were further validated in vivo: 1) in zebrafish embryo models (BT40 and DKFZ-BT66 yolk sac injection) and 2) in NSG mice (BT40 orthotopic PDX) including in vivo pharmacokinetic and -dynamic analyses. Ulixertinib inhibited MAPK pathway activity in all models and reduced cell viability in the BRAF V600E mutated cell line at concentrations in the nanomolar range. In vivo pharmacokinetic and -dynamic analyses showed penetrance of the drug into mouse brain tissue and on-target activity, with concentrations above the in vitro IC50 and reduction of MAPK activity. Ulixertinib treatment slowed tumor growth and significantly increased survival in NSG mice with BT40 xenografts. Ulixertinib showed indications for anti-proliferative synergy in vitro in combination with MEK inhibitors (trametinib, binimetinib) or BH3 mimetics (navitoclax, A-1331852). Combinations with chemotherapy (carboplatin, vinblastine) were at most additive. Indications for synergy with binimetinib and navitoclax were confirmed in the zebrafish embryo models. In the NSG mouse model, the combination of ulixertinib with senolytics induced effects on tumor growth and survival comparable to ulixertinib monotherapy. Ulixertinib shows promising potential as a clinically relevant therapeutic option for the treatment of pLGG to be further investigated in upcoming clinical trials. Potential synergism with MEK inhibitors and BH3 mimetics was noted and warrants further investigation. Oxford University Press 2022-06-03 /pmc/articles/PMC9164732/ http://dx.doi.org/10.1093/neuonc/noac079.339 Text en © The Author(s) 2022. Published by Oxford University Press on behalf of the Society for Neuro-Oncology. https://creativecommons.org/licenses/by-nc/4.0/This is an Open Access article distributed under the terms of the Creative Commons Attribution-NonCommercial License (https://creativecommons.org/licenses/by-nc/4.0/), which permits non-commercial re-use, distribution, and reproduction in any medium, provided the original work is properly cited. For commercial re-use, please contact journals.permissions@oup.com
spellingShingle Low Grade Glioma
Sigaud, Romain
Rösch, Lisa
Gatzweiler, Charlotte
Benzel, Julia
von Soosten, Laura
Peterziel, Heike
Najafi, Sara
Ayhan, Simay
Gerloff, Xena F
Hofmann, Nina
Büdenbender, Isabel
Foerster, Kathrin I
Burhenne, Jürgen
Longuespée, Rémi
van Tilburg, Cornelis M
Jones, David T W
Pfister, Stefan M
Knoerzer, Deborah
Kreider, Brent
Sauter, Max
Pajtler, Kristian W
Zuckermann, Marc
Oehme, Ina
Witt, Olaf
Milde, Till
LGG-25. The first-in-class ERK inhibitor ulixertinib (BVD-523) shows activity in MAPK-driven pediatric low-grade glioma models as single agent and in combination with MEK inhibitors or senolytics
title LGG-25. The first-in-class ERK inhibitor ulixertinib (BVD-523) shows activity in MAPK-driven pediatric low-grade glioma models as single agent and in combination with MEK inhibitors or senolytics
title_full LGG-25. The first-in-class ERK inhibitor ulixertinib (BVD-523) shows activity in MAPK-driven pediatric low-grade glioma models as single agent and in combination with MEK inhibitors or senolytics
title_fullStr LGG-25. The first-in-class ERK inhibitor ulixertinib (BVD-523) shows activity in MAPK-driven pediatric low-grade glioma models as single agent and in combination with MEK inhibitors or senolytics
title_full_unstemmed LGG-25. The first-in-class ERK inhibitor ulixertinib (BVD-523) shows activity in MAPK-driven pediatric low-grade glioma models as single agent and in combination with MEK inhibitors or senolytics
title_short LGG-25. The first-in-class ERK inhibitor ulixertinib (BVD-523) shows activity in MAPK-driven pediatric low-grade glioma models as single agent and in combination with MEK inhibitors or senolytics
title_sort lgg-25. the first-in-class erk inhibitor ulixertinib (bvd-523) shows activity in mapk-driven pediatric low-grade glioma models as single agent and in combination with mek inhibitors or senolytics
topic Low Grade Glioma
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9164732/
http://dx.doi.org/10.1093/neuonc/noac079.339
work_keys_str_mv AT sigaudromain lgg25thefirstinclasserkinhibitorulixertinibbvd523showsactivityinmapkdrivenpediatriclowgradegliomamodelsassingleagentandincombinationwithmekinhibitorsorsenolytics
AT roschlisa lgg25thefirstinclasserkinhibitorulixertinibbvd523showsactivityinmapkdrivenpediatriclowgradegliomamodelsassingleagentandincombinationwithmekinhibitorsorsenolytics
AT gatzweilercharlotte lgg25thefirstinclasserkinhibitorulixertinibbvd523showsactivityinmapkdrivenpediatriclowgradegliomamodelsassingleagentandincombinationwithmekinhibitorsorsenolytics
AT benzeljulia lgg25thefirstinclasserkinhibitorulixertinibbvd523showsactivityinmapkdrivenpediatriclowgradegliomamodelsassingleagentandincombinationwithmekinhibitorsorsenolytics
AT vonsoostenlaura lgg25thefirstinclasserkinhibitorulixertinibbvd523showsactivityinmapkdrivenpediatriclowgradegliomamodelsassingleagentandincombinationwithmekinhibitorsorsenolytics
AT peterzielheike lgg25thefirstinclasserkinhibitorulixertinibbvd523showsactivityinmapkdrivenpediatriclowgradegliomamodelsassingleagentandincombinationwithmekinhibitorsorsenolytics
AT najafisara lgg25thefirstinclasserkinhibitorulixertinibbvd523showsactivityinmapkdrivenpediatriclowgradegliomamodelsassingleagentandincombinationwithmekinhibitorsorsenolytics
AT ayhansimay lgg25thefirstinclasserkinhibitorulixertinibbvd523showsactivityinmapkdrivenpediatriclowgradegliomamodelsassingleagentandincombinationwithmekinhibitorsorsenolytics
AT gerloffxenaf lgg25thefirstinclasserkinhibitorulixertinibbvd523showsactivityinmapkdrivenpediatriclowgradegliomamodelsassingleagentandincombinationwithmekinhibitorsorsenolytics
AT hofmannnina lgg25thefirstinclasserkinhibitorulixertinibbvd523showsactivityinmapkdrivenpediatriclowgradegliomamodelsassingleagentandincombinationwithmekinhibitorsorsenolytics
AT budenbenderisabel lgg25thefirstinclasserkinhibitorulixertinibbvd523showsactivityinmapkdrivenpediatriclowgradegliomamodelsassingleagentandincombinationwithmekinhibitorsorsenolytics
AT foersterkathrini lgg25thefirstinclasserkinhibitorulixertinibbvd523showsactivityinmapkdrivenpediatriclowgradegliomamodelsassingleagentandincombinationwithmekinhibitorsorsenolytics
AT burhennejurgen lgg25thefirstinclasserkinhibitorulixertinibbvd523showsactivityinmapkdrivenpediatriclowgradegliomamodelsassingleagentandincombinationwithmekinhibitorsorsenolytics
AT longuespeeremi lgg25thefirstinclasserkinhibitorulixertinibbvd523showsactivityinmapkdrivenpediatriclowgradegliomamodelsassingleagentandincombinationwithmekinhibitorsorsenolytics
AT vantilburgcornelism lgg25thefirstinclasserkinhibitorulixertinibbvd523showsactivityinmapkdrivenpediatriclowgradegliomamodelsassingleagentandincombinationwithmekinhibitorsorsenolytics
AT jonesdavidtw lgg25thefirstinclasserkinhibitorulixertinibbvd523showsactivityinmapkdrivenpediatriclowgradegliomamodelsassingleagentandincombinationwithmekinhibitorsorsenolytics
AT pfisterstefanm lgg25thefirstinclasserkinhibitorulixertinibbvd523showsactivityinmapkdrivenpediatriclowgradegliomamodelsassingleagentandincombinationwithmekinhibitorsorsenolytics
AT knoerzerdeborah lgg25thefirstinclasserkinhibitorulixertinibbvd523showsactivityinmapkdrivenpediatriclowgradegliomamodelsassingleagentandincombinationwithmekinhibitorsorsenolytics
AT kreiderbrent lgg25thefirstinclasserkinhibitorulixertinibbvd523showsactivityinmapkdrivenpediatriclowgradegliomamodelsassingleagentandincombinationwithmekinhibitorsorsenolytics
AT sautermax lgg25thefirstinclasserkinhibitorulixertinibbvd523showsactivityinmapkdrivenpediatriclowgradegliomamodelsassingleagentandincombinationwithmekinhibitorsorsenolytics
AT pajtlerkristianw lgg25thefirstinclasserkinhibitorulixertinibbvd523showsactivityinmapkdrivenpediatriclowgradegliomamodelsassingleagentandincombinationwithmekinhibitorsorsenolytics
AT zuckermannmarc lgg25thefirstinclasserkinhibitorulixertinibbvd523showsactivityinmapkdrivenpediatriclowgradegliomamodelsassingleagentandincombinationwithmekinhibitorsorsenolytics
AT oehmeina lgg25thefirstinclasserkinhibitorulixertinibbvd523showsactivityinmapkdrivenpediatriclowgradegliomamodelsassingleagentandincombinationwithmekinhibitorsorsenolytics
AT wittolaf lgg25thefirstinclasserkinhibitorulixertinibbvd523showsactivityinmapkdrivenpediatriclowgradegliomamodelsassingleagentandincombinationwithmekinhibitorsorsenolytics
AT mildetill lgg25thefirstinclasserkinhibitorulixertinibbvd523showsactivityinmapkdrivenpediatriclowgradegliomamodelsassingleagentandincombinationwithmekinhibitorsorsenolytics