Cargando…

Towards elimination of Lymphatic Filariasis in Kenya: improving advocacy, communication and social mobilization activities for mass drug administration, a qualitative study

INTRODUCTION: The Kenya Breaking Transmission Strategy for Neglected Tropical Diseases (NTD) from 2019 to 2023 intensifies advocacy, coordination, and partnerships. The purpose of this study was to explore views and experiences of stakeholders and health workers on ways of improving the Advocacy, Co...

Descripción completa

Detalles Bibliográficos
Autores principales: Kibe, Lydiah W., Kimani, Bridget W., Okoyo, Collins, Omondi, Wyckliff P., Sultani, Hadley M., Njomo, Doris W.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2022
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9167906/
https://www.ncbi.nlm.nih.gov/pubmed/35668465
http://dx.doi.org/10.1186/s40794-022-00172-8
_version_ 1784720879585853440
author Kibe, Lydiah W.
Kimani, Bridget W.
Okoyo, Collins
Omondi, Wyckliff P.
Sultani, Hadley M.
Njomo, Doris W.
author_facet Kibe, Lydiah W.
Kimani, Bridget W.
Okoyo, Collins
Omondi, Wyckliff P.
Sultani, Hadley M.
Njomo, Doris W.
author_sort Kibe, Lydiah W.
collection PubMed
description INTRODUCTION: The Kenya Breaking Transmission Strategy for Neglected Tropical Diseases (NTD) from 2019 to 2023 intensifies advocacy, coordination, and partnerships. The purpose of this study was to explore views and experiences of stakeholders and health workers on ways of improving the Advocacy, Communication and Social Mobilization (ACSM) activities of Mass Drug Administration (MDA) for Lymphatic Filariasis (LF) programs through participatory approaches in Kilifi County, Kenya. METHODS: Two wards were purposely selected in the Kaloleni sub-county, Kilifi County, where there was an average treatment coverage of 56% in 2015, 50.5% in 2016. Qualitative data collection methods were employed, which included participatory meetings with county stakeholders to understand their views, experiences, and suggestions on how ACSM strategies can be improved in MDA for LF. Twelve In-Depth Interviews (IDIs) were conducted (six with opinion leaders and six with Community Health Extension Workers (CHEWs) and two semi-structured interviews (SSIs) were held with county and sub-county coordinators involved in MDA administration. The aim was to better to understand their perceptions of the NTD program about ACSM, challenges to ACSM strategies, and ways to improve the strategies for ACSM in MDA for LF. The Data was organized and classified into codes and themes using QSR NVIVO version 12. RESULTS: The study observed the low participation of stakeholders in the ACSM activities of MDA for LF and identified potential areas for stakeholders’ involvement to strengthen the activities. Challenges hindering effective implementation of ACSM activities include late delivery of Information, Educational and Communication (IEC) and few IEC materials, insufficient funding, inadequate time allocated to reach the assigned households with messages, messaging, and packaging of information for dissemination due to the vastness of the area. The stakeholders recommended innovative strategies and techniques to improve ACSM activities. DISCUSSION AND CONCLUSION: The results of this study show key challenges to ACSM implementation of MDA for LF. Implementers need to pay attention to these challenges to enhance the effectiveness of MDA per the Kenya NTD Breaking Transmission Strategy. ACSM efforts in MDA for LF control and elimination should be linked with overarching efforts to mainstream partnerships and coordination in control and elimination. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s40794-022-00172-8.
format Online
Article
Text
id pubmed-9167906
institution National Center for Biotechnology Information
language English
publishDate 2022
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-91679062022-06-07 Towards elimination of Lymphatic Filariasis in Kenya: improving advocacy, communication and social mobilization activities for mass drug administration, a qualitative study Kibe, Lydiah W. Kimani, Bridget W. Okoyo, Collins Omondi, Wyckliff P. Sultani, Hadley M. Njomo, Doris W. Trop Dis Travel Med Vaccines Research INTRODUCTION: The Kenya Breaking Transmission Strategy for Neglected Tropical Diseases (NTD) from 2019 to 2023 intensifies advocacy, coordination, and partnerships. The purpose of this study was to explore views and experiences of stakeholders and health workers on ways of improving the Advocacy, Communication and Social Mobilization (ACSM) activities of Mass Drug Administration (MDA) for Lymphatic Filariasis (LF) programs through participatory approaches in Kilifi County, Kenya. METHODS: Two wards were purposely selected in the Kaloleni sub-county, Kilifi County, where there was an average treatment coverage of 56% in 2015, 50.5% in 2016. Qualitative data collection methods were employed, which included participatory meetings with county stakeholders to understand their views, experiences, and suggestions on how ACSM strategies can be improved in MDA for LF. Twelve In-Depth Interviews (IDIs) were conducted (six with opinion leaders and six with Community Health Extension Workers (CHEWs) and two semi-structured interviews (SSIs) were held with county and sub-county coordinators involved in MDA administration. The aim was to better to understand their perceptions of the NTD program about ACSM, challenges to ACSM strategies, and ways to improve the strategies for ACSM in MDA for LF. The Data was organized and classified into codes and themes using QSR NVIVO version 12. RESULTS: The study observed the low participation of stakeholders in the ACSM activities of MDA for LF and identified potential areas for stakeholders’ involvement to strengthen the activities. Challenges hindering effective implementation of ACSM activities include late delivery of Information, Educational and Communication (IEC) and few IEC materials, insufficient funding, inadequate time allocated to reach the assigned households with messages, messaging, and packaging of information for dissemination due to the vastness of the area. The stakeholders recommended innovative strategies and techniques to improve ACSM activities. DISCUSSION AND CONCLUSION: The results of this study show key challenges to ACSM implementation of MDA for LF. Implementers need to pay attention to these challenges to enhance the effectiveness of MDA per the Kenya NTD Breaking Transmission Strategy. ACSM efforts in MDA for LF control and elimination should be linked with overarching efforts to mainstream partnerships and coordination in control and elimination. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s40794-022-00172-8. BioMed Central 2022-06-06 /pmc/articles/PMC9167906/ /pubmed/35668465 http://dx.doi.org/10.1186/s40794-022-00172-8 Text en © The Author(s) 2022 https://creativecommons.org/licenses/by/4.0/Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data.
spellingShingle Research
Kibe, Lydiah W.
Kimani, Bridget W.
Okoyo, Collins
Omondi, Wyckliff P.
Sultani, Hadley M.
Njomo, Doris W.
Towards elimination of Lymphatic Filariasis in Kenya: improving advocacy, communication and social mobilization activities for mass drug administration, a qualitative study
title Towards elimination of Lymphatic Filariasis in Kenya: improving advocacy, communication and social mobilization activities for mass drug administration, a qualitative study
title_full Towards elimination of Lymphatic Filariasis in Kenya: improving advocacy, communication and social mobilization activities for mass drug administration, a qualitative study
title_fullStr Towards elimination of Lymphatic Filariasis in Kenya: improving advocacy, communication and social mobilization activities for mass drug administration, a qualitative study
title_full_unstemmed Towards elimination of Lymphatic Filariasis in Kenya: improving advocacy, communication and social mobilization activities for mass drug administration, a qualitative study
title_short Towards elimination of Lymphatic Filariasis in Kenya: improving advocacy, communication and social mobilization activities for mass drug administration, a qualitative study
title_sort towards elimination of lymphatic filariasis in kenya: improving advocacy, communication and social mobilization activities for mass drug administration, a qualitative study
topic Research
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9167906/
https://www.ncbi.nlm.nih.gov/pubmed/35668465
http://dx.doi.org/10.1186/s40794-022-00172-8
work_keys_str_mv AT kibelydiahw towardseliminationoflymphaticfilariasisinkenyaimprovingadvocacycommunicationandsocialmobilizationactivitiesformassdrugadministrationaqualitativestudy
AT kimanibridgetw towardseliminationoflymphaticfilariasisinkenyaimprovingadvocacycommunicationandsocialmobilizationactivitiesformassdrugadministrationaqualitativestudy
AT okoyocollins towardseliminationoflymphaticfilariasisinkenyaimprovingadvocacycommunicationandsocialmobilizationactivitiesformassdrugadministrationaqualitativestudy
AT omondiwyckliffp towardseliminationoflymphaticfilariasisinkenyaimprovingadvocacycommunicationandsocialmobilizationactivitiesformassdrugadministrationaqualitativestudy
AT sultanihadleym towardseliminationoflymphaticfilariasisinkenyaimprovingadvocacycommunicationandsocialmobilizationactivitiesformassdrugadministrationaqualitativestudy
AT njomodorisw towardseliminationoflymphaticfilariasisinkenyaimprovingadvocacycommunicationandsocialmobilizationactivitiesformassdrugadministrationaqualitativestudy