Cargando…
Implementation of respondent driven sampling in Nairobi, Kenya, for tracking key family planning indicators among adolescents and youth: lessons learnt
OBJECTIVE: Adolescents and youth constitute a significant proportion of the population in developing nations. Conventional survey methods risk missing adolescents/youth because their family planning/contraception (FP/C) behavior is hidden. Respondent-driven sampling (RDS), a modified chain-referral...
Autores principales: | , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2022
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9171948/ https://www.ncbi.nlm.nih.gov/pubmed/35672785 http://dx.doi.org/10.1186/s13104-022-06038-8 |
_version_ | 1784721782801956864 |
---|---|
author | Thiongo, Mary Gichangi, Peter Macho, Patrick K. Byrne, Meagan E. Kimani, Peter Waithaka, Michael Radloff, Scott Anglewicz, Philip Decker, Michele R. |
author_facet | Thiongo, Mary Gichangi, Peter Macho, Patrick K. Byrne, Meagan E. Kimani, Peter Waithaka, Michael Radloff, Scott Anglewicz, Philip Decker, Michele R. |
author_sort | Thiongo, Mary |
collection | PubMed |
description | OBJECTIVE: Adolescents and youth constitute a significant proportion of the population in developing nations. Conventional survey methods risk missing adolescents/youth because their family planning/contraception (FP/C) behavior is hidden. Respondent-driven sampling (RDS), a modified chain-referral recruitment sampling approach, was used to reach unmarried adolescents/youth aged 15–24 in Nairobi, Kenya to measure key FP/C indicators. Seeds were selected and issued with three coupons which they used to invite their peers, male or female, to participate in the study. Referred participants were also given coupons to invite others till sample size was achieved. We report on key implementation parameters following standard RDS reporting recommendations. RESULTS: A total of 1674 coupons were issued to generate a sample size of 1354. Coupon return rate was 82.7%. Study participants self-administered most survey questions and missing data was low. Differential enrolment by gender was seen with 56.0% of females recruiting females while 44.0% of males recruited males. In about two months, it was possible to reach the desired sample size using RDS methodology. Implementation challenges included presentation of expired coupons, recruitment of ineligible participants and difficulty recruiting seeds and recruits from affluent neighborhoods. Challenges were consistent with RDS implementation in other settings and populations. RDS can complement standard surveillance/survey approaches, particularly for mobile populations like adolescents/youth. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s13104-022-06038-8. |
format | Online Article Text |
id | pubmed-9171948 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2022 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-91719482022-06-08 Implementation of respondent driven sampling in Nairobi, Kenya, for tracking key family planning indicators among adolescents and youth: lessons learnt Thiongo, Mary Gichangi, Peter Macho, Patrick K. Byrne, Meagan E. Kimani, Peter Waithaka, Michael Radloff, Scott Anglewicz, Philip Decker, Michele R. BMC Res Notes Research Note OBJECTIVE: Adolescents and youth constitute a significant proportion of the population in developing nations. Conventional survey methods risk missing adolescents/youth because their family planning/contraception (FP/C) behavior is hidden. Respondent-driven sampling (RDS), a modified chain-referral recruitment sampling approach, was used to reach unmarried adolescents/youth aged 15–24 in Nairobi, Kenya to measure key FP/C indicators. Seeds were selected and issued with three coupons which they used to invite their peers, male or female, to participate in the study. Referred participants were also given coupons to invite others till sample size was achieved. We report on key implementation parameters following standard RDS reporting recommendations. RESULTS: A total of 1674 coupons were issued to generate a sample size of 1354. Coupon return rate was 82.7%. Study participants self-administered most survey questions and missing data was low. Differential enrolment by gender was seen with 56.0% of females recruiting females while 44.0% of males recruited males. In about two months, it was possible to reach the desired sample size using RDS methodology. Implementation challenges included presentation of expired coupons, recruitment of ineligible participants and difficulty recruiting seeds and recruits from affluent neighborhoods. Challenges were consistent with RDS implementation in other settings and populations. RDS can complement standard surveillance/survey approaches, particularly for mobile populations like adolescents/youth. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s13104-022-06038-8. BioMed Central 2022-06-07 /pmc/articles/PMC9171948/ /pubmed/35672785 http://dx.doi.org/10.1186/s13104-022-06038-8 Text en © The Author(s) 2022 https://creativecommons.org/licenses/by/4.0/Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data. |
spellingShingle | Research Note Thiongo, Mary Gichangi, Peter Macho, Patrick K. Byrne, Meagan E. Kimani, Peter Waithaka, Michael Radloff, Scott Anglewicz, Philip Decker, Michele R. Implementation of respondent driven sampling in Nairobi, Kenya, for tracking key family planning indicators among adolescents and youth: lessons learnt |
title | Implementation of respondent driven sampling in Nairobi, Kenya, for tracking key family planning indicators among adolescents and youth: lessons learnt |
title_full | Implementation of respondent driven sampling in Nairobi, Kenya, for tracking key family planning indicators among adolescents and youth: lessons learnt |
title_fullStr | Implementation of respondent driven sampling in Nairobi, Kenya, for tracking key family planning indicators among adolescents and youth: lessons learnt |
title_full_unstemmed | Implementation of respondent driven sampling in Nairobi, Kenya, for tracking key family planning indicators among adolescents and youth: lessons learnt |
title_short | Implementation of respondent driven sampling in Nairobi, Kenya, for tracking key family planning indicators among adolescents and youth: lessons learnt |
title_sort | implementation of respondent driven sampling in nairobi, kenya, for tracking key family planning indicators among adolescents and youth: lessons learnt |
topic | Research Note |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9171948/ https://www.ncbi.nlm.nih.gov/pubmed/35672785 http://dx.doi.org/10.1186/s13104-022-06038-8 |
work_keys_str_mv | AT thiongomary implementationofrespondentdrivensamplinginnairobikenyafortrackingkeyfamilyplanningindicatorsamongadolescentsandyouthlessonslearnt AT gichangipeter implementationofrespondentdrivensamplinginnairobikenyafortrackingkeyfamilyplanningindicatorsamongadolescentsandyouthlessonslearnt AT machopatrickk implementationofrespondentdrivensamplinginnairobikenyafortrackingkeyfamilyplanningindicatorsamongadolescentsandyouthlessonslearnt AT byrnemeagane implementationofrespondentdrivensamplinginnairobikenyafortrackingkeyfamilyplanningindicatorsamongadolescentsandyouthlessonslearnt AT kimanipeter implementationofrespondentdrivensamplinginnairobikenyafortrackingkeyfamilyplanningindicatorsamongadolescentsandyouthlessonslearnt AT waithakamichael implementationofrespondentdrivensamplinginnairobikenyafortrackingkeyfamilyplanningindicatorsamongadolescentsandyouthlessonslearnt AT radloffscott implementationofrespondentdrivensamplinginnairobikenyafortrackingkeyfamilyplanningindicatorsamongadolescentsandyouthlessonslearnt AT anglewiczphilip implementationofrespondentdrivensamplinginnairobikenyafortrackingkeyfamilyplanningindicatorsamongadolescentsandyouthlessonslearnt AT deckermicheler implementationofrespondentdrivensamplinginnairobikenyafortrackingkeyfamilyplanningindicatorsamongadolescentsandyouthlessonslearnt |