Cargando…
Circulating Hematopoietic (HSC) and Very-Small Embryonic like (VSEL) Stem Cells in Newly Diagnosed Childhood Diabetes type 1 – Novel Parameters of Beta Cell Destruction/Regeneration Balance and Possible Prognostic Factors of Future Disease Course
AIMS/HYPOTHESIS: We aimed to evaluate hematopoietic stem cells (HSC) and very small embryonic-like stem cells (VSEL) mobilization to establish their role in residual beta cell function maintenance and partial remission occurrence in children newly diagnosed with type 1 diabetes. METHODS: We recruite...
Autores principales: | , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Springer US
2021
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9209363/ https://www.ncbi.nlm.nih.gov/pubmed/34510360 http://dx.doi.org/10.1007/s12015-021-10250-7 |
_version_ | 1784729938068242432 |
---|---|
author | Jamiołkowska-Sztabkowska, Milena Grubczak, Kamil Starosz, Aleksandra Krętowska-Grunwald, Anna Krętowska, Magdalena Parfienowicz, Zuzanna Moniuszko, Marcin Bossowski, Artur Głowińska-Olszewska, Barbara |
author_facet | Jamiołkowska-Sztabkowska, Milena Grubczak, Kamil Starosz, Aleksandra Krętowska-Grunwald, Anna Krętowska, Magdalena Parfienowicz, Zuzanna Moniuszko, Marcin Bossowski, Artur Głowińska-Olszewska, Barbara |
author_sort | Jamiołkowska-Sztabkowska, Milena |
collection | PubMed |
description | AIMS/HYPOTHESIS: We aimed to evaluate hematopoietic stem cells (HSC) and very small embryonic-like stem cells (VSEL) mobilization to establish their role in residual beta cell function maintenance and partial remission occurrence in children newly diagnosed with type 1 diabetes. METHODS: We recruited 59 type 1 diabetic patients (aged 6–18 years) monitored for 2 years, and 31 healthy children as a control group. HSC and VSEL levels were assessed at disease onset in PBMC isolated from whole peripheral blood with the use of flow cytometry. An assessment of beta cell function was based on C-peptide secretion. Studied groups were stratified on the basis of VSEL, HSC and/or C-peptide median levels in regard to beta cell function and partial remission. RESULTS: Patients with higher stimulated C-peptide secretion at disease onset demonstrated lower levels of HSC (p < 0.05), while for VSEL and VSEL/HSC ratio higher values were observed (p < 0.05). Accordingly, after 2 years follow-up, patients with higher C-peptide secretion presented lower initial levels of HSC and higher VSEL/HSC ratio (p < 0.05). Patients with lower values of HSC levels demonstrated a tendency for better partial remission prevalence in the first 3 to 6 months after diagnosis. CONCLUSIONS: These clinical observations indicate a possible significant role of HSC and VSEL in maintaining residual beta cell function in type 1 diabetic patients. GRAPHICAL ABSTRACT: [Image: see text] SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1007/s12015-021-10250-7. |
format | Online Article Text |
id | pubmed-9209363 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2021 |
publisher | Springer US |
record_format | MEDLINE/PubMed |
spelling | pubmed-92093632022-06-22 Circulating Hematopoietic (HSC) and Very-Small Embryonic like (VSEL) Stem Cells in Newly Diagnosed Childhood Diabetes type 1 – Novel Parameters of Beta Cell Destruction/Regeneration Balance and Possible Prognostic Factors of Future Disease Course Jamiołkowska-Sztabkowska, Milena Grubczak, Kamil Starosz, Aleksandra Krętowska-Grunwald, Anna Krętowska, Magdalena Parfienowicz, Zuzanna Moniuszko, Marcin Bossowski, Artur Głowińska-Olszewska, Barbara Stem Cell Rev Rep Article AIMS/HYPOTHESIS: We aimed to evaluate hematopoietic stem cells (HSC) and very small embryonic-like stem cells (VSEL) mobilization to establish their role in residual beta cell function maintenance and partial remission occurrence in children newly diagnosed with type 1 diabetes. METHODS: We recruited 59 type 1 diabetic patients (aged 6–18 years) monitored for 2 years, and 31 healthy children as a control group. HSC and VSEL levels were assessed at disease onset in PBMC isolated from whole peripheral blood with the use of flow cytometry. An assessment of beta cell function was based on C-peptide secretion. Studied groups were stratified on the basis of VSEL, HSC and/or C-peptide median levels in regard to beta cell function and partial remission. RESULTS: Patients with higher stimulated C-peptide secretion at disease onset demonstrated lower levels of HSC (p < 0.05), while for VSEL and VSEL/HSC ratio higher values were observed (p < 0.05). Accordingly, after 2 years follow-up, patients with higher C-peptide secretion presented lower initial levels of HSC and higher VSEL/HSC ratio (p < 0.05). Patients with lower values of HSC levels demonstrated a tendency for better partial remission prevalence in the first 3 to 6 months after diagnosis. CONCLUSIONS: These clinical observations indicate a possible significant role of HSC and VSEL in maintaining residual beta cell function in type 1 diabetic patients. GRAPHICAL ABSTRACT: [Image: see text] SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1007/s12015-021-10250-7. Springer US 2021-09-12 2022 /pmc/articles/PMC9209363/ /pubmed/34510360 http://dx.doi.org/10.1007/s12015-021-10250-7 Text en © The Author(s) 2021 https://creativecommons.org/licenses/by/4.0/Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . |
spellingShingle | Article Jamiołkowska-Sztabkowska, Milena Grubczak, Kamil Starosz, Aleksandra Krętowska-Grunwald, Anna Krętowska, Magdalena Parfienowicz, Zuzanna Moniuszko, Marcin Bossowski, Artur Głowińska-Olszewska, Barbara Circulating Hematopoietic (HSC) and Very-Small Embryonic like (VSEL) Stem Cells in Newly Diagnosed Childhood Diabetes type 1 – Novel Parameters of Beta Cell Destruction/Regeneration Balance and Possible Prognostic Factors of Future Disease Course |
title | Circulating Hematopoietic (HSC) and Very-Small Embryonic like (VSEL) Stem Cells in Newly Diagnosed Childhood Diabetes type 1 – Novel Parameters of Beta Cell Destruction/Regeneration Balance and Possible Prognostic Factors of Future Disease Course |
title_full | Circulating Hematopoietic (HSC) and Very-Small Embryonic like (VSEL) Stem Cells in Newly Diagnosed Childhood Diabetes type 1 – Novel Parameters of Beta Cell Destruction/Regeneration Balance and Possible Prognostic Factors of Future Disease Course |
title_fullStr | Circulating Hematopoietic (HSC) and Very-Small Embryonic like (VSEL) Stem Cells in Newly Diagnosed Childhood Diabetes type 1 – Novel Parameters of Beta Cell Destruction/Regeneration Balance and Possible Prognostic Factors of Future Disease Course |
title_full_unstemmed | Circulating Hematopoietic (HSC) and Very-Small Embryonic like (VSEL) Stem Cells in Newly Diagnosed Childhood Diabetes type 1 – Novel Parameters of Beta Cell Destruction/Regeneration Balance and Possible Prognostic Factors of Future Disease Course |
title_short | Circulating Hematopoietic (HSC) and Very-Small Embryonic like (VSEL) Stem Cells in Newly Diagnosed Childhood Diabetes type 1 – Novel Parameters of Beta Cell Destruction/Regeneration Balance and Possible Prognostic Factors of Future Disease Course |
title_sort | circulating hematopoietic (hsc) and very-small embryonic like (vsel) stem cells in newly diagnosed childhood diabetes type 1 – novel parameters of beta cell destruction/regeneration balance and possible prognostic factors of future disease course |
topic | Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9209363/ https://www.ncbi.nlm.nih.gov/pubmed/34510360 http://dx.doi.org/10.1007/s12015-021-10250-7 |
work_keys_str_mv | AT jamiołkowskasztabkowskamilena circulatinghematopoietichscandverysmallembryoniclikevselstemcellsinnewlydiagnosedchildhooddiabetestype1novelparametersofbetacelldestructionregenerationbalanceandpossibleprognosticfactorsoffuturediseasecourse AT grubczakkamil circulatinghematopoietichscandverysmallembryoniclikevselstemcellsinnewlydiagnosedchildhooddiabetestype1novelparametersofbetacelldestructionregenerationbalanceandpossibleprognosticfactorsoffuturediseasecourse AT staroszaleksandra circulatinghematopoietichscandverysmallembryoniclikevselstemcellsinnewlydiagnosedchildhooddiabetestype1novelparametersofbetacelldestructionregenerationbalanceandpossibleprognosticfactorsoffuturediseasecourse AT kretowskagrunwaldanna circulatinghematopoietichscandverysmallembryoniclikevselstemcellsinnewlydiagnosedchildhooddiabetestype1novelparametersofbetacelldestructionregenerationbalanceandpossibleprognosticfactorsoffuturediseasecourse AT kretowskamagdalena circulatinghematopoietichscandverysmallembryoniclikevselstemcellsinnewlydiagnosedchildhooddiabetestype1novelparametersofbetacelldestructionregenerationbalanceandpossibleprognosticfactorsoffuturediseasecourse AT parfienowiczzuzanna circulatinghematopoietichscandverysmallembryoniclikevselstemcellsinnewlydiagnosedchildhooddiabetestype1novelparametersofbetacelldestructionregenerationbalanceandpossibleprognosticfactorsoffuturediseasecourse AT moniuszkomarcin circulatinghematopoietichscandverysmallembryoniclikevselstemcellsinnewlydiagnosedchildhooddiabetestype1novelparametersofbetacelldestructionregenerationbalanceandpossibleprognosticfactorsoffuturediseasecourse AT bossowskiartur circulatinghematopoietichscandverysmallembryoniclikevselstemcellsinnewlydiagnosedchildhooddiabetestype1novelparametersofbetacelldestructionregenerationbalanceandpossibleprognosticfactorsoffuturediseasecourse AT głowinskaolszewskabarbara circulatinghematopoietichscandverysmallembryoniclikevselstemcellsinnewlydiagnosedchildhooddiabetestype1novelparametersofbetacelldestructionregenerationbalanceandpossibleprognosticfactorsoffuturediseasecourse |