Cargando…
PET Imaging of the Neuropeptide Y System: A Systematic Review
Neuropeptide Y (NPY) is a vastly studied biological peptide with numerous physiological functions that activate the NPY receptor family (Y(1), Y(2), Y(4) and Y(5)). Moreover, these receptors are correlated with the pathophysiology of several diseases such as feeding disorders, anxiety, metabolic dis...
Autores principales: | , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
MDPI
2022
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9227365/ https://www.ncbi.nlm.nih.gov/pubmed/35744852 http://dx.doi.org/10.3390/molecules27123726 |
_version_ | 1784734156925698048 |
---|---|
author | Fonseca, Inês C. F. Castelo-Branco, Miguel Cavadas, Cláudia Abrunhosa, Antero J. |
author_facet | Fonseca, Inês C. F. Castelo-Branco, Miguel Cavadas, Cláudia Abrunhosa, Antero J. |
author_sort | Fonseca, Inês C. F. |
collection | PubMed |
description | Neuropeptide Y (NPY) is a vastly studied biological peptide with numerous physiological functions that activate the NPY receptor family (Y(1), Y(2), Y(4) and Y(5)). Moreover, these receptors are correlated with the pathophysiology of several diseases such as feeding disorders, anxiety, metabolic diseases, neurodegenerative diseases, some types of cancers and others. In order to deepen the knowledge of NPY receptors’ functions and molecular mechanisms, neuroimaging techniques such as positron emission tomography (PET) have been used. The development of new radiotracers for the different NPY receptors and their subsequent PET studies have led to significant insights into molecular mechanisms involving NPY receptors. This article provides a systematic review of the imaging biomarkers that have been developed as PET tracers in order to study the NPY receptor family. |
format | Online Article Text |
id | pubmed-9227365 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2022 |
publisher | MDPI |
record_format | MEDLINE/PubMed |
spelling | pubmed-92273652022-06-25 PET Imaging of the Neuropeptide Y System: A Systematic Review Fonseca, Inês C. F. Castelo-Branco, Miguel Cavadas, Cláudia Abrunhosa, Antero J. Molecules Review Neuropeptide Y (NPY) is a vastly studied biological peptide with numerous physiological functions that activate the NPY receptor family (Y(1), Y(2), Y(4) and Y(5)). Moreover, these receptors are correlated with the pathophysiology of several diseases such as feeding disorders, anxiety, metabolic diseases, neurodegenerative diseases, some types of cancers and others. In order to deepen the knowledge of NPY receptors’ functions and molecular mechanisms, neuroimaging techniques such as positron emission tomography (PET) have been used. The development of new radiotracers for the different NPY receptors and their subsequent PET studies have led to significant insights into molecular mechanisms involving NPY receptors. This article provides a systematic review of the imaging biomarkers that have been developed as PET tracers in order to study the NPY receptor family. MDPI 2022-06-09 /pmc/articles/PMC9227365/ /pubmed/35744852 http://dx.doi.org/10.3390/molecules27123726 Text en © 2022 by the authors. https://creativecommons.org/licenses/by/4.0/Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/). |
spellingShingle | Review Fonseca, Inês C. F. Castelo-Branco, Miguel Cavadas, Cláudia Abrunhosa, Antero J. PET Imaging of the Neuropeptide Y System: A Systematic Review |
title | PET Imaging of the Neuropeptide Y System: A Systematic Review |
title_full | PET Imaging of the Neuropeptide Y System: A Systematic Review |
title_fullStr | PET Imaging of the Neuropeptide Y System: A Systematic Review |
title_full_unstemmed | PET Imaging of the Neuropeptide Y System: A Systematic Review |
title_short | PET Imaging of the Neuropeptide Y System: A Systematic Review |
title_sort | pet imaging of the neuropeptide y system: a systematic review |
topic | Review |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9227365/ https://www.ncbi.nlm.nih.gov/pubmed/35744852 http://dx.doi.org/10.3390/molecules27123726 |
work_keys_str_mv | AT fonsecainescf petimagingoftheneuropeptideysystemasystematicreview AT castelobrancomiguel petimagingoftheneuropeptideysystemasystematicreview AT cavadasclaudia petimagingoftheneuropeptideysystemasystematicreview AT abrunhosaanteroj petimagingoftheneuropeptideysystemasystematicreview |