Cargando…

PET Imaging of the Neuropeptide Y System: A Systematic Review

Neuropeptide Y (NPY) is a vastly studied biological peptide with numerous physiological functions that activate the NPY receptor family (Y(1), Y(2), Y(4) and Y(5)). Moreover, these receptors are correlated with the pathophysiology of several diseases such as feeding disorders, anxiety, metabolic dis...

Descripción completa

Detalles Bibliográficos
Autores principales: Fonseca, Inês C. F., Castelo-Branco, Miguel, Cavadas, Cláudia, Abrunhosa, Antero J.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: MDPI 2022
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9227365/
https://www.ncbi.nlm.nih.gov/pubmed/35744852
http://dx.doi.org/10.3390/molecules27123726
_version_ 1784734156925698048
author Fonseca, Inês C. F.
Castelo-Branco, Miguel
Cavadas, Cláudia
Abrunhosa, Antero J.
author_facet Fonseca, Inês C. F.
Castelo-Branco, Miguel
Cavadas, Cláudia
Abrunhosa, Antero J.
author_sort Fonseca, Inês C. F.
collection PubMed
description Neuropeptide Y (NPY) is a vastly studied biological peptide with numerous physiological functions that activate the NPY receptor family (Y(1), Y(2), Y(4) and Y(5)). Moreover, these receptors are correlated with the pathophysiology of several diseases such as feeding disorders, anxiety, metabolic diseases, neurodegenerative diseases, some types of cancers and others. In order to deepen the knowledge of NPY receptors’ functions and molecular mechanisms, neuroimaging techniques such as positron emission tomography (PET) have been used. The development of new radiotracers for the different NPY receptors and their subsequent PET studies have led to significant insights into molecular mechanisms involving NPY receptors. This article provides a systematic review of the imaging biomarkers that have been developed as PET tracers in order to study the NPY receptor family.
format Online
Article
Text
id pubmed-9227365
institution National Center for Biotechnology Information
language English
publishDate 2022
publisher MDPI
record_format MEDLINE/PubMed
spelling pubmed-92273652022-06-25 PET Imaging of the Neuropeptide Y System: A Systematic Review Fonseca, Inês C. F. Castelo-Branco, Miguel Cavadas, Cláudia Abrunhosa, Antero J. Molecules Review Neuropeptide Y (NPY) is a vastly studied biological peptide with numerous physiological functions that activate the NPY receptor family (Y(1), Y(2), Y(4) and Y(5)). Moreover, these receptors are correlated with the pathophysiology of several diseases such as feeding disorders, anxiety, metabolic diseases, neurodegenerative diseases, some types of cancers and others. In order to deepen the knowledge of NPY receptors’ functions and molecular mechanisms, neuroimaging techniques such as positron emission tomography (PET) have been used. The development of new radiotracers for the different NPY receptors and their subsequent PET studies have led to significant insights into molecular mechanisms involving NPY receptors. This article provides a systematic review of the imaging biomarkers that have been developed as PET tracers in order to study the NPY receptor family. MDPI 2022-06-09 /pmc/articles/PMC9227365/ /pubmed/35744852 http://dx.doi.org/10.3390/molecules27123726 Text en © 2022 by the authors. https://creativecommons.org/licenses/by/4.0/Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
spellingShingle Review
Fonseca, Inês C. F.
Castelo-Branco, Miguel
Cavadas, Cláudia
Abrunhosa, Antero J.
PET Imaging of the Neuropeptide Y System: A Systematic Review
title PET Imaging of the Neuropeptide Y System: A Systematic Review
title_full PET Imaging of the Neuropeptide Y System: A Systematic Review
title_fullStr PET Imaging of the Neuropeptide Y System: A Systematic Review
title_full_unstemmed PET Imaging of the Neuropeptide Y System: A Systematic Review
title_short PET Imaging of the Neuropeptide Y System: A Systematic Review
title_sort pet imaging of the neuropeptide y system: a systematic review
topic Review
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9227365/
https://www.ncbi.nlm.nih.gov/pubmed/35744852
http://dx.doi.org/10.3390/molecules27123726
work_keys_str_mv AT fonsecainescf petimagingoftheneuropeptideysystemasystematicreview
AT castelobrancomiguel petimagingoftheneuropeptideysystemasystematicreview
AT cavadasclaudia petimagingoftheneuropeptideysystemasystematicreview
AT abrunhosaanteroj petimagingoftheneuropeptideysystemasystematicreview