Cargando…
The genome sequences of the male and female green-veined white, Pieris napi (Linnaeus, 1758)
We present genome assemblies from a male and female Pieris napi (the green-veined white; Arthropoda; Insecta; Lepidoptera; Pieridae). The genome sequences of the male and female are 320 and 319 megabases in span, respectively. The majority of the assembly (99.79% of the male assembly, 99.88% of the...
Autores principales: | , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
F1000 Research Limited
2021
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9257262/ https://www.ncbi.nlm.nih.gov/pubmed/35846179 http://dx.doi.org/10.12688/wellcomeopenres.17277.1 |
_version_ | 1784741306603405312 |
---|---|
author | Lohse, Konrad Hayward, Alex Ebdon, Sam |
author_facet | Lohse, Konrad Hayward, Alex Ebdon, Sam |
author_sort | Lohse, Konrad |
collection | PubMed |
description | We present genome assemblies from a male and female Pieris napi (the green-veined white; Arthropoda; Insecta; Lepidoptera; Pieridae). The genome sequences of the male and female are 320 and 319 megabases in span, respectively. The majority of the assembly (99.79% of the male assembly, 99.88% of the female) is scaffolded into 24 autosomal pseudomolecules, with the Z sex chromosome assembled for the male and Z and W chromosomes assembled for the female. Gene annotation of the male assembly on Ensembl has identified 13,221 protein coding genes. |
format | Online Article Text |
id | pubmed-9257262 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2021 |
publisher | F1000 Research Limited |
record_format | MEDLINE/PubMed |
spelling | pubmed-92572622022-07-15 The genome sequences of the male and female green-veined white, Pieris napi (Linnaeus, 1758) Lohse, Konrad Hayward, Alex Ebdon, Sam Wellcome Open Res Data Note We present genome assemblies from a male and female Pieris napi (the green-veined white; Arthropoda; Insecta; Lepidoptera; Pieridae). The genome sequences of the male and female are 320 and 319 megabases in span, respectively. The majority of the assembly (99.79% of the male assembly, 99.88% of the female) is scaffolded into 24 autosomal pseudomolecules, with the Z sex chromosome assembled for the male and Z and W chromosomes assembled for the female. Gene annotation of the male assembly on Ensembl has identified 13,221 protein coding genes. F1000 Research Limited 2021-10-26 /pmc/articles/PMC9257262/ /pubmed/35846179 http://dx.doi.org/10.12688/wellcomeopenres.17277.1 Text en Copyright: © 2021 Lohse K et al. https://creativecommons.org/licenses/by/4.0/This is an open access article distributed under the terms of the Creative Commons Attribution Licence, which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. |
spellingShingle | Data Note Lohse, Konrad Hayward, Alex Ebdon, Sam The genome sequences of the male and female green-veined white, Pieris napi (Linnaeus, 1758) |
title | The genome sequences of the male and female green-veined white,
Pieris napi (Linnaeus, 1758) |
title_full | The genome sequences of the male and female green-veined white,
Pieris napi (Linnaeus, 1758) |
title_fullStr | The genome sequences of the male and female green-veined white,
Pieris napi (Linnaeus, 1758) |
title_full_unstemmed | The genome sequences of the male and female green-veined white,
Pieris napi (Linnaeus, 1758) |
title_short | The genome sequences of the male and female green-veined white,
Pieris napi (Linnaeus, 1758) |
title_sort | genome sequences of the male and female green-veined white,
pieris napi (linnaeus, 1758) |
topic | Data Note |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9257262/ https://www.ncbi.nlm.nih.gov/pubmed/35846179 http://dx.doi.org/10.12688/wellcomeopenres.17277.1 |
work_keys_str_mv | AT lohsekonrad thegenomesequencesofthemaleandfemalegreenveinedwhitepierisnapilinnaeus1758 AT haywardalex thegenomesequencesofthemaleandfemalegreenveinedwhitepierisnapilinnaeus1758 AT ebdonsam thegenomesequencesofthemaleandfemalegreenveinedwhitepierisnapilinnaeus1758 AT thegenomesequencesofthemaleandfemalegreenveinedwhitepierisnapilinnaeus1758 AT thegenomesequencesofthemaleandfemalegreenveinedwhitepierisnapilinnaeus1758 AT thegenomesequencesofthemaleandfemalegreenveinedwhitepierisnapilinnaeus1758 AT thegenomesequencesofthemaleandfemalegreenveinedwhitepierisnapilinnaeus1758 AT thegenomesequencesofthemaleandfemalegreenveinedwhitepierisnapilinnaeus1758 AT lohsekonrad genomesequencesofthemaleandfemalegreenveinedwhitepierisnapilinnaeus1758 AT haywardalex genomesequencesofthemaleandfemalegreenveinedwhitepierisnapilinnaeus1758 AT ebdonsam genomesequencesofthemaleandfemalegreenveinedwhitepierisnapilinnaeus1758 AT genomesequencesofthemaleandfemalegreenveinedwhitepierisnapilinnaeus1758 AT genomesequencesofthemaleandfemalegreenveinedwhitepierisnapilinnaeus1758 AT genomesequencesofthemaleandfemalegreenveinedwhitepierisnapilinnaeus1758 AT genomesequencesofthemaleandfemalegreenveinedwhitepierisnapilinnaeus1758 AT genomesequencesofthemaleandfemalegreenveinedwhitepierisnapilinnaeus1758 |