Cargando…

The genome sequences of the male and female green-veined white, Pieris napi (Linnaeus, 1758)

We present genome assemblies from a male and female Pieris napi (the green-veined white; Arthropoda; Insecta; Lepidoptera; Pieridae). The genome sequences of the male and female are 320 and 319 megabases in span, respectively. The majority of the assembly (99.79% of the male assembly, 99.88% of the...

Descripción completa

Detalles Bibliográficos
Autores principales: Lohse, Konrad, Hayward, Alex, Ebdon, Sam
Formato: Online Artículo Texto
Lenguaje:English
Publicado: F1000 Research Limited 2021
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9257262/
https://www.ncbi.nlm.nih.gov/pubmed/35846179
http://dx.doi.org/10.12688/wellcomeopenres.17277.1
_version_ 1784741306603405312
author Lohse, Konrad
Hayward, Alex
Ebdon, Sam
author_facet Lohse, Konrad
Hayward, Alex
Ebdon, Sam
author_sort Lohse, Konrad
collection PubMed
description We present genome assemblies from a male and female Pieris napi (the green-veined white; Arthropoda; Insecta; Lepidoptera; Pieridae). The genome sequences of the male and female are 320 and 319 megabases in span, respectively. The majority of the assembly (99.79% of the male assembly, 99.88% of the female) is scaffolded into 24 autosomal pseudomolecules, with the Z sex chromosome assembled for the male and Z and W chromosomes assembled for the female. Gene annotation of the male assembly on Ensembl has identified 13,221 protein coding genes.
format Online
Article
Text
id pubmed-9257262
institution National Center for Biotechnology Information
language English
publishDate 2021
publisher F1000 Research Limited
record_format MEDLINE/PubMed
spelling pubmed-92572622022-07-15 The genome sequences of the male and female green-veined white, Pieris napi (Linnaeus, 1758) Lohse, Konrad Hayward, Alex Ebdon, Sam Wellcome Open Res Data Note We present genome assemblies from a male and female Pieris napi (the green-veined white; Arthropoda; Insecta; Lepidoptera; Pieridae). The genome sequences of the male and female are 320 and 319 megabases in span, respectively. The majority of the assembly (99.79% of the male assembly, 99.88% of the female) is scaffolded into 24 autosomal pseudomolecules, with the Z sex chromosome assembled for the male and Z and W chromosomes assembled for the female. Gene annotation of the male assembly on Ensembl has identified 13,221 protein coding genes. F1000 Research Limited 2021-10-26 /pmc/articles/PMC9257262/ /pubmed/35846179 http://dx.doi.org/10.12688/wellcomeopenres.17277.1 Text en Copyright: © 2021 Lohse K et al. https://creativecommons.org/licenses/by/4.0/This is an open access article distributed under the terms of the Creative Commons Attribution Licence, which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited.
spellingShingle Data Note
Lohse, Konrad
Hayward, Alex
Ebdon, Sam
The genome sequences of the male and female green-veined white, Pieris napi (Linnaeus, 1758)
title The genome sequences of the male and female green-veined white, Pieris napi (Linnaeus, 1758)
title_full The genome sequences of the male and female green-veined white, Pieris napi (Linnaeus, 1758)
title_fullStr The genome sequences of the male and female green-veined white, Pieris napi (Linnaeus, 1758)
title_full_unstemmed The genome sequences of the male and female green-veined white, Pieris napi (Linnaeus, 1758)
title_short The genome sequences of the male and female green-veined white, Pieris napi (Linnaeus, 1758)
title_sort genome sequences of the male and female green-veined white, pieris napi (linnaeus, 1758)
topic Data Note
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9257262/
https://www.ncbi.nlm.nih.gov/pubmed/35846179
http://dx.doi.org/10.12688/wellcomeopenres.17277.1
work_keys_str_mv AT lohsekonrad thegenomesequencesofthemaleandfemalegreenveinedwhitepierisnapilinnaeus1758
AT haywardalex thegenomesequencesofthemaleandfemalegreenveinedwhitepierisnapilinnaeus1758
AT ebdonsam thegenomesequencesofthemaleandfemalegreenveinedwhitepierisnapilinnaeus1758
AT thegenomesequencesofthemaleandfemalegreenveinedwhitepierisnapilinnaeus1758
AT thegenomesequencesofthemaleandfemalegreenveinedwhitepierisnapilinnaeus1758
AT thegenomesequencesofthemaleandfemalegreenveinedwhitepierisnapilinnaeus1758
AT thegenomesequencesofthemaleandfemalegreenveinedwhitepierisnapilinnaeus1758
AT thegenomesequencesofthemaleandfemalegreenveinedwhitepierisnapilinnaeus1758
AT lohsekonrad genomesequencesofthemaleandfemalegreenveinedwhitepierisnapilinnaeus1758
AT haywardalex genomesequencesofthemaleandfemalegreenveinedwhitepierisnapilinnaeus1758
AT ebdonsam genomesequencesofthemaleandfemalegreenveinedwhitepierisnapilinnaeus1758
AT genomesequencesofthemaleandfemalegreenveinedwhitepierisnapilinnaeus1758
AT genomesequencesofthemaleandfemalegreenveinedwhitepierisnapilinnaeus1758
AT genomesequencesofthemaleandfemalegreenveinedwhitepierisnapilinnaeus1758
AT genomesequencesofthemaleandfemalegreenveinedwhitepierisnapilinnaeus1758
AT genomesequencesofthemaleandfemalegreenveinedwhitepierisnapilinnaeus1758