Cargando…
Comprehensive Analysis of Role of Cyclin-Dependent Kinases Family Members in Colorectal Cancer
BACKGROUND: Cyclin-dependent kinases (CDKs) are cell cycle regulators, and abnormal activation can accelerate tumor cell proliferation. However, The relation between CDKs dysregulation to colorectal cancer incidence and progression have not been examined in detail. Methods:Differences in CDKs expres...
Autores principales: | , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Frontiers Media S.A.
2022
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9258493/ https://www.ncbi.nlm.nih.gov/pubmed/35814446 http://dx.doi.org/10.3389/fonc.2022.921710 |
_version_ | 1784741566413275136 |
---|---|
author | Guan, Liping Tang, Yuanyuan Li, Guanghua Qin, Zhao Li, Shaoshan |
author_facet | Guan, Liping Tang, Yuanyuan Li, Guanghua Qin, Zhao Li, Shaoshan |
author_sort | Guan, Liping |
collection | PubMed |
description | BACKGROUND: Cyclin-dependent kinases (CDKs) are cell cycle regulators, and abnormal activation can accelerate tumor cell proliferation. However, The relation between CDKs dysregulation to colorectal cancer incidence and progression have not been examined in detail. Methods:Differences in CDKs expression between colorectal cancer and normal tissues, associations between expression and clinical prognosis, incidence and frequencies of CDKs gene mutations, and the influences of CDKs on tumor infiltration by immune cells were examined by analyses of Oncomine, Gene Expression Profiling Interactive Analysis, Kaplan-Meier plotter, cBioPortal, GeneMANIA, and TIMER databases. RESULTS: Colorectal cancer tissues showed enhanced expression levels of CDKs 1/2/4/5/6/8/12/13/19 but reduced CDK3 expression. CDK7 was highly expressed in some colorectal cancer tissues but downregulated in others. Expression levels of CDK1/3/4/7/8/10/11b/13/18/19/20 were correlated with clinical stage, and CDK 5/10/12/16 expression levels predicted prognosis and survival. Differential CDKs expression correlated with cell cycle progression, amino acid polypeptide modifications, and activation of other protein kinases. Expression levels of all CDKs except CDK16 were correlated with infiltration of CD4+T, CD8+T, B and Tregs cells. CONCLUSIONS: CDK 1 and 4 could be used as diagnostic biomarkers for CRC. CDK 5/10/12/16 can be utilized as prognostic biomarkers. |
format | Online Article Text |
id | pubmed-9258493 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2022 |
publisher | Frontiers Media S.A. |
record_format | MEDLINE/PubMed |
spelling | pubmed-92584932022-07-07 Comprehensive Analysis of Role of Cyclin-Dependent Kinases Family Members in Colorectal Cancer Guan, Liping Tang, Yuanyuan Li, Guanghua Qin, Zhao Li, Shaoshan Front Oncol Oncology BACKGROUND: Cyclin-dependent kinases (CDKs) are cell cycle regulators, and abnormal activation can accelerate tumor cell proliferation. However, The relation between CDKs dysregulation to colorectal cancer incidence and progression have not been examined in detail. Methods:Differences in CDKs expression between colorectal cancer and normal tissues, associations between expression and clinical prognosis, incidence and frequencies of CDKs gene mutations, and the influences of CDKs on tumor infiltration by immune cells were examined by analyses of Oncomine, Gene Expression Profiling Interactive Analysis, Kaplan-Meier plotter, cBioPortal, GeneMANIA, and TIMER databases. RESULTS: Colorectal cancer tissues showed enhanced expression levels of CDKs 1/2/4/5/6/8/12/13/19 but reduced CDK3 expression. CDK7 was highly expressed in some colorectal cancer tissues but downregulated in others. Expression levels of CDK1/3/4/7/8/10/11b/13/18/19/20 were correlated with clinical stage, and CDK 5/10/12/16 expression levels predicted prognosis and survival. Differential CDKs expression correlated with cell cycle progression, amino acid polypeptide modifications, and activation of other protein kinases. Expression levels of all CDKs except CDK16 were correlated with infiltration of CD4+T, CD8+T, B and Tregs cells. CONCLUSIONS: CDK 1 and 4 could be used as diagnostic biomarkers for CRC. CDK 5/10/12/16 can be utilized as prognostic biomarkers. Frontiers Media S.A. 2022-06-22 /pmc/articles/PMC9258493/ /pubmed/35814446 http://dx.doi.org/10.3389/fonc.2022.921710 Text en Copyright © 2022 Guan, Tang, Li, Qin and Li https://creativecommons.org/licenses/by/4.0/This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) and the copyright owner(s) are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms. |
spellingShingle | Oncology Guan, Liping Tang, Yuanyuan Li, Guanghua Qin, Zhao Li, Shaoshan Comprehensive Analysis of Role of Cyclin-Dependent Kinases Family Members in Colorectal Cancer |
title | Comprehensive Analysis of Role of Cyclin-Dependent Kinases Family Members in Colorectal Cancer |
title_full | Comprehensive Analysis of Role of Cyclin-Dependent Kinases Family Members in Colorectal Cancer |
title_fullStr | Comprehensive Analysis of Role of Cyclin-Dependent Kinases Family Members in Colorectal Cancer |
title_full_unstemmed | Comprehensive Analysis of Role of Cyclin-Dependent Kinases Family Members in Colorectal Cancer |
title_short | Comprehensive Analysis of Role of Cyclin-Dependent Kinases Family Members in Colorectal Cancer |
title_sort | comprehensive analysis of role of cyclin-dependent kinases family members in colorectal cancer |
topic | Oncology |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9258493/ https://www.ncbi.nlm.nih.gov/pubmed/35814446 http://dx.doi.org/10.3389/fonc.2022.921710 |
work_keys_str_mv | AT guanliping comprehensiveanalysisofroleofcyclindependentkinasesfamilymembersincolorectalcancer AT tangyuanyuan comprehensiveanalysisofroleofcyclindependentkinasesfamilymembersincolorectalcancer AT liguanghua comprehensiveanalysisofroleofcyclindependentkinasesfamilymembersincolorectalcancer AT qinzhao comprehensiveanalysisofroleofcyclindependentkinasesfamilymembersincolorectalcancer AT lishaoshan comprehensiveanalysisofroleofcyclindependentkinasesfamilymembersincolorectalcancer |