Cargando…

Comprehensive Analysis of Role of Cyclin-Dependent Kinases Family Members in Colorectal Cancer

BACKGROUND: Cyclin-dependent kinases (CDKs) are cell cycle regulators, and abnormal activation can accelerate tumor cell proliferation. However, The relation between CDKs dysregulation to colorectal cancer incidence and progression have not been examined in detail. Methods:Differences in CDKs expres...

Descripción completa

Detalles Bibliográficos
Autores principales: Guan, Liping, Tang, Yuanyuan, Li, Guanghua, Qin, Zhao, Li, Shaoshan
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Frontiers Media S.A. 2022
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9258493/
https://www.ncbi.nlm.nih.gov/pubmed/35814446
http://dx.doi.org/10.3389/fonc.2022.921710
_version_ 1784741566413275136
author Guan, Liping
Tang, Yuanyuan
Li, Guanghua
Qin, Zhao
Li, Shaoshan
author_facet Guan, Liping
Tang, Yuanyuan
Li, Guanghua
Qin, Zhao
Li, Shaoshan
author_sort Guan, Liping
collection PubMed
description BACKGROUND: Cyclin-dependent kinases (CDKs) are cell cycle regulators, and abnormal activation can accelerate tumor cell proliferation. However, The relation between CDKs dysregulation to colorectal cancer incidence and progression have not been examined in detail. Methods:Differences in CDKs expression between colorectal cancer and normal tissues, associations between expression and clinical prognosis, incidence and frequencies of CDKs gene mutations, and the influences of CDKs on tumor infiltration by immune cells were examined by analyses of Oncomine, Gene Expression Profiling Interactive Analysis, Kaplan-Meier plotter, cBioPortal, GeneMANIA, and TIMER databases. RESULTS: Colorectal cancer tissues showed enhanced expression levels of CDKs 1/2/4/5/6/8/12/13/19 but reduced CDK3 expression. CDK7 was highly expressed in some colorectal cancer tissues but downregulated in others. Expression levels of CDK1/3/4/7/8/10/11b/13/18/19/20 were correlated with clinical stage, and CDK 5/10/12/16 expression levels predicted prognosis and survival. Differential CDKs expression correlated with cell cycle progression, amino acid polypeptide modifications, and activation of other protein kinases. Expression levels of all CDKs except CDK16 were correlated with infiltration of CD4+T, CD8+T, B and Tregs cells. CONCLUSIONS: CDK 1 and 4 could be used as diagnostic biomarkers for CRC. CDK 5/10/12/16 can be utilized as prognostic biomarkers.
format Online
Article
Text
id pubmed-9258493
institution National Center for Biotechnology Information
language English
publishDate 2022
publisher Frontiers Media S.A.
record_format MEDLINE/PubMed
spelling pubmed-92584932022-07-07 Comprehensive Analysis of Role of Cyclin-Dependent Kinases Family Members in Colorectal Cancer Guan, Liping Tang, Yuanyuan Li, Guanghua Qin, Zhao Li, Shaoshan Front Oncol Oncology BACKGROUND: Cyclin-dependent kinases (CDKs) are cell cycle regulators, and abnormal activation can accelerate tumor cell proliferation. However, The relation between CDKs dysregulation to colorectal cancer incidence and progression have not been examined in detail. Methods:Differences in CDKs expression between colorectal cancer and normal tissues, associations between expression and clinical prognosis, incidence and frequencies of CDKs gene mutations, and the influences of CDKs on tumor infiltration by immune cells were examined by analyses of Oncomine, Gene Expression Profiling Interactive Analysis, Kaplan-Meier plotter, cBioPortal, GeneMANIA, and TIMER databases. RESULTS: Colorectal cancer tissues showed enhanced expression levels of CDKs 1/2/4/5/6/8/12/13/19 but reduced CDK3 expression. CDK7 was highly expressed in some colorectal cancer tissues but downregulated in others. Expression levels of CDK1/3/4/7/8/10/11b/13/18/19/20 were correlated with clinical stage, and CDK 5/10/12/16 expression levels predicted prognosis and survival. Differential CDKs expression correlated with cell cycle progression, amino acid polypeptide modifications, and activation of other protein kinases. Expression levels of all CDKs except CDK16 were correlated with infiltration of CD4+T, CD8+T, B and Tregs cells. CONCLUSIONS: CDK 1 and 4 could be used as diagnostic biomarkers for CRC. CDK 5/10/12/16 can be utilized as prognostic biomarkers. Frontiers Media S.A. 2022-06-22 /pmc/articles/PMC9258493/ /pubmed/35814446 http://dx.doi.org/10.3389/fonc.2022.921710 Text en Copyright © 2022 Guan, Tang, Li, Qin and Li https://creativecommons.org/licenses/by/4.0/This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) and the copyright owner(s) are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms.
spellingShingle Oncology
Guan, Liping
Tang, Yuanyuan
Li, Guanghua
Qin, Zhao
Li, Shaoshan
Comprehensive Analysis of Role of Cyclin-Dependent Kinases Family Members in Colorectal Cancer
title Comprehensive Analysis of Role of Cyclin-Dependent Kinases Family Members in Colorectal Cancer
title_full Comprehensive Analysis of Role of Cyclin-Dependent Kinases Family Members in Colorectal Cancer
title_fullStr Comprehensive Analysis of Role of Cyclin-Dependent Kinases Family Members in Colorectal Cancer
title_full_unstemmed Comprehensive Analysis of Role of Cyclin-Dependent Kinases Family Members in Colorectal Cancer
title_short Comprehensive Analysis of Role of Cyclin-Dependent Kinases Family Members in Colorectal Cancer
title_sort comprehensive analysis of role of cyclin-dependent kinases family members in colorectal cancer
topic Oncology
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9258493/
https://www.ncbi.nlm.nih.gov/pubmed/35814446
http://dx.doi.org/10.3389/fonc.2022.921710
work_keys_str_mv AT guanliping comprehensiveanalysisofroleofcyclindependentkinasesfamilymembersincolorectalcancer
AT tangyuanyuan comprehensiveanalysisofroleofcyclindependentkinasesfamilymembersincolorectalcancer
AT liguanghua comprehensiveanalysisofroleofcyclindependentkinasesfamilymembersincolorectalcancer
AT qinzhao comprehensiveanalysisofroleofcyclindependentkinasesfamilymembersincolorectalcancer
AT lishaoshan comprehensiveanalysisofroleofcyclindependentkinasesfamilymembersincolorectalcancer