Cargando…
Dopamine Suppresses Osteogenic Differentiation of Rat Bone Marrow-Derived Mesenchymal Stem Cells via AKT/GSK-3β/β-Catenin Signaling Pathway
Nervous system is critically involved in bone homeostasis and osteogenesis. Dopamine, a pivotal neurotransmitter, plays a crucial role in sympathetic regulation, hormone secretion, immune activation, and blood pressure regulation. However, the role of dopamine on osteogenic differentiation of rat bo...
Autores principales: | , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Hindawi
2022
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9259353/ https://www.ncbi.nlm.nih.gov/pubmed/35813889 http://dx.doi.org/10.1155/2022/4154440 |
_version_ | 1784741760239403008 |
---|---|
author | Kuang, Zhili Chen, Zheng Tu, Shaoqin Mai, Zhihui Chen, Lin Kang, Xiaoning Chen, Xiaochuan Wei, Jiaming Wang, Yuxuan Peng, Yun Ai, Hong |
author_facet | Kuang, Zhili Chen, Zheng Tu, Shaoqin Mai, Zhihui Chen, Lin Kang, Xiaoning Chen, Xiaochuan Wei, Jiaming Wang, Yuxuan Peng, Yun Ai, Hong |
author_sort | Kuang, Zhili |
collection | PubMed |
description | Nervous system is critically involved in bone homeostasis and osteogenesis. Dopamine, a pivotal neurotransmitter, plays a crucial role in sympathetic regulation, hormone secretion, immune activation, and blood pressure regulation. However, the role of dopamine on osteogenic differentiation of rat bone marrow-derived mesenchymal stem cells (rBMSCs) remains poorly understood. In this study, we firstly investigated the effect of dopamine on the apoptosis, proliferation, and osteogenic differentiation of rBMSCs. Dopamine did not, however, interfere with the apoptosis and proliferation of rBMSCs. Interestingly, dopamine suppressed the osteogenic differentiation of rBMSCs, as characterized by reduced ALP staining, ALP activity, mineralized nodule formation, and the mRNA and protein levels of osteogenesis-related genes (Col1a1, Alp, Runx2, Opn, and Ocn). Furthermore, dopamine inactivated AKT/GSK-3β/β-catenin signaling pathway. Treatment of LiCl (GSK-3β inhibitor) rescued the inhibitory effects of dopamine on osteogenic differentiation of rBMSCs. LY294002 (AKT inhibitor) administration exacerbated the inhibitory effects of dopamine on osteogenic differentiation of rBMSCs. Taken together, these findings indicate that dopamine suppresses osteogenic differentiation of rBMSCs via AKT/GSK-3β/β-catenin signaling pathway. Our study provides new insights into the role of neurotransmitters in bone homeostasis. |
format | Online Article Text |
id | pubmed-9259353 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2022 |
publisher | Hindawi |
record_format | MEDLINE/PubMed |
spelling | pubmed-92593532022-07-07 Dopamine Suppresses Osteogenic Differentiation of Rat Bone Marrow-Derived Mesenchymal Stem Cells via AKT/GSK-3β/β-Catenin Signaling Pathway Kuang, Zhili Chen, Zheng Tu, Shaoqin Mai, Zhihui Chen, Lin Kang, Xiaoning Chen, Xiaochuan Wei, Jiaming Wang, Yuxuan Peng, Yun Ai, Hong Stem Cells Int Research Article Nervous system is critically involved in bone homeostasis and osteogenesis. Dopamine, a pivotal neurotransmitter, plays a crucial role in sympathetic regulation, hormone secretion, immune activation, and blood pressure regulation. However, the role of dopamine on osteogenic differentiation of rat bone marrow-derived mesenchymal stem cells (rBMSCs) remains poorly understood. In this study, we firstly investigated the effect of dopamine on the apoptosis, proliferation, and osteogenic differentiation of rBMSCs. Dopamine did not, however, interfere with the apoptosis and proliferation of rBMSCs. Interestingly, dopamine suppressed the osteogenic differentiation of rBMSCs, as characterized by reduced ALP staining, ALP activity, mineralized nodule formation, and the mRNA and protein levels of osteogenesis-related genes (Col1a1, Alp, Runx2, Opn, and Ocn). Furthermore, dopamine inactivated AKT/GSK-3β/β-catenin signaling pathway. Treatment of LiCl (GSK-3β inhibitor) rescued the inhibitory effects of dopamine on osteogenic differentiation of rBMSCs. LY294002 (AKT inhibitor) administration exacerbated the inhibitory effects of dopamine on osteogenic differentiation of rBMSCs. Taken together, these findings indicate that dopamine suppresses osteogenic differentiation of rBMSCs via AKT/GSK-3β/β-catenin signaling pathway. Our study provides new insights into the role of neurotransmitters in bone homeostasis. Hindawi 2022-06-29 /pmc/articles/PMC9259353/ /pubmed/35813889 http://dx.doi.org/10.1155/2022/4154440 Text en Copyright © 2022 Zhili Kuang et al. https://creativecommons.org/licenses/by/4.0/This is an open access article distributed under the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. |
spellingShingle | Research Article Kuang, Zhili Chen, Zheng Tu, Shaoqin Mai, Zhihui Chen, Lin Kang, Xiaoning Chen, Xiaochuan Wei, Jiaming Wang, Yuxuan Peng, Yun Ai, Hong Dopamine Suppresses Osteogenic Differentiation of Rat Bone Marrow-Derived Mesenchymal Stem Cells via AKT/GSK-3β/β-Catenin Signaling Pathway |
title | Dopamine Suppresses Osteogenic Differentiation of Rat Bone Marrow-Derived Mesenchymal Stem Cells via AKT/GSK-3β/β-Catenin Signaling Pathway |
title_full | Dopamine Suppresses Osteogenic Differentiation of Rat Bone Marrow-Derived Mesenchymal Stem Cells via AKT/GSK-3β/β-Catenin Signaling Pathway |
title_fullStr | Dopamine Suppresses Osteogenic Differentiation of Rat Bone Marrow-Derived Mesenchymal Stem Cells via AKT/GSK-3β/β-Catenin Signaling Pathway |
title_full_unstemmed | Dopamine Suppresses Osteogenic Differentiation of Rat Bone Marrow-Derived Mesenchymal Stem Cells via AKT/GSK-3β/β-Catenin Signaling Pathway |
title_short | Dopamine Suppresses Osteogenic Differentiation of Rat Bone Marrow-Derived Mesenchymal Stem Cells via AKT/GSK-3β/β-Catenin Signaling Pathway |
title_sort | dopamine suppresses osteogenic differentiation of rat bone marrow-derived mesenchymal stem cells via akt/gsk-3β/β-catenin signaling pathway |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9259353/ https://www.ncbi.nlm.nih.gov/pubmed/35813889 http://dx.doi.org/10.1155/2022/4154440 |
work_keys_str_mv | AT kuangzhili dopaminesuppressesosteogenicdifferentiationofratbonemarrowderivedmesenchymalstemcellsviaaktgsk3bbcateninsignalingpathway AT chenzheng dopaminesuppressesosteogenicdifferentiationofratbonemarrowderivedmesenchymalstemcellsviaaktgsk3bbcateninsignalingpathway AT tushaoqin dopaminesuppressesosteogenicdifferentiationofratbonemarrowderivedmesenchymalstemcellsviaaktgsk3bbcateninsignalingpathway AT maizhihui dopaminesuppressesosteogenicdifferentiationofratbonemarrowderivedmesenchymalstemcellsviaaktgsk3bbcateninsignalingpathway AT chenlin dopaminesuppressesosteogenicdifferentiationofratbonemarrowderivedmesenchymalstemcellsviaaktgsk3bbcateninsignalingpathway AT kangxiaoning dopaminesuppressesosteogenicdifferentiationofratbonemarrowderivedmesenchymalstemcellsviaaktgsk3bbcateninsignalingpathway AT chenxiaochuan dopaminesuppressesosteogenicdifferentiationofratbonemarrowderivedmesenchymalstemcellsviaaktgsk3bbcateninsignalingpathway AT weijiaming dopaminesuppressesosteogenicdifferentiationofratbonemarrowderivedmesenchymalstemcellsviaaktgsk3bbcateninsignalingpathway AT wangyuxuan dopaminesuppressesosteogenicdifferentiationofratbonemarrowderivedmesenchymalstemcellsviaaktgsk3bbcateninsignalingpathway AT pengyun dopaminesuppressesosteogenicdifferentiationofratbonemarrowderivedmesenchymalstemcellsviaaktgsk3bbcateninsignalingpathway AT aihong dopaminesuppressesosteogenicdifferentiationofratbonemarrowderivedmesenchymalstemcellsviaaktgsk3bbcateninsignalingpathway |