Cargando…

Dopamine Suppresses Osteogenic Differentiation of Rat Bone Marrow-Derived Mesenchymal Stem Cells via AKT/GSK-3β/β-Catenin Signaling Pathway

Nervous system is critically involved in bone homeostasis and osteogenesis. Dopamine, a pivotal neurotransmitter, plays a crucial role in sympathetic regulation, hormone secretion, immune activation, and blood pressure regulation. However, the role of dopamine on osteogenic differentiation of rat bo...

Descripción completa

Detalles Bibliográficos
Autores principales: Kuang, Zhili, Chen, Zheng, Tu, Shaoqin, Mai, Zhihui, Chen, Lin, Kang, Xiaoning, Chen, Xiaochuan, Wei, Jiaming, Wang, Yuxuan, Peng, Yun, Ai, Hong
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Hindawi 2022
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9259353/
https://www.ncbi.nlm.nih.gov/pubmed/35813889
http://dx.doi.org/10.1155/2022/4154440
_version_ 1784741760239403008
author Kuang, Zhili
Chen, Zheng
Tu, Shaoqin
Mai, Zhihui
Chen, Lin
Kang, Xiaoning
Chen, Xiaochuan
Wei, Jiaming
Wang, Yuxuan
Peng, Yun
Ai, Hong
author_facet Kuang, Zhili
Chen, Zheng
Tu, Shaoqin
Mai, Zhihui
Chen, Lin
Kang, Xiaoning
Chen, Xiaochuan
Wei, Jiaming
Wang, Yuxuan
Peng, Yun
Ai, Hong
author_sort Kuang, Zhili
collection PubMed
description Nervous system is critically involved in bone homeostasis and osteogenesis. Dopamine, a pivotal neurotransmitter, plays a crucial role in sympathetic regulation, hormone secretion, immune activation, and blood pressure regulation. However, the role of dopamine on osteogenic differentiation of rat bone marrow-derived mesenchymal stem cells (rBMSCs) remains poorly understood. In this study, we firstly investigated the effect of dopamine on the apoptosis, proliferation, and osteogenic differentiation of rBMSCs. Dopamine did not, however, interfere with the apoptosis and proliferation of rBMSCs. Interestingly, dopamine suppressed the osteogenic differentiation of rBMSCs, as characterized by reduced ALP staining, ALP activity, mineralized nodule formation, and the mRNA and protein levels of osteogenesis-related genes (Col1a1, Alp, Runx2, Opn, and Ocn). Furthermore, dopamine inactivated AKT/GSK-3β/β-catenin signaling pathway. Treatment of LiCl (GSK-3β inhibitor) rescued the inhibitory effects of dopamine on osteogenic differentiation of rBMSCs. LY294002 (AKT inhibitor) administration exacerbated the inhibitory effects of dopamine on osteogenic differentiation of rBMSCs. Taken together, these findings indicate that dopamine suppresses osteogenic differentiation of rBMSCs via AKT/GSK-3β/β-catenin signaling pathway. Our study provides new insights into the role of neurotransmitters in bone homeostasis.
format Online
Article
Text
id pubmed-9259353
institution National Center for Biotechnology Information
language English
publishDate 2022
publisher Hindawi
record_format MEDLINE/PubMed
spelling pubmed-92593532022-07-07 Dopamine Suppresses Osteogenic Differentiation of Rat Bone Marrow-Derived Mesenchymal Stem Cells via AKT/GSK-3β/β-Catenin Signaling Pathway Kuang, Zhili Chen, Zheng Tu, Shaoqin Mai, Zhihui Chen, Lin Kang, Xiaoning Chen, Xiaochuan Wei, Jiaming Wang, Yuxuan Peng, Yun Ai, Hong Stem Cells Int Research Article Nervous system is critically involved in bone homeostasis and osteogenesis. Dopamine, a pivotal neurotransmitter, plays a crucial role in sympathetic regulation, hormone secretion, immune activation, and blood pressure regulation. However, the role of dopamine on osteogenic differentiation of rat bone marrow-derived mesenchymal stem cells (rBMSCs) remains poorly understood. In this study, we firstly investigated the effect of dopamine on the apoptosis, proliferation, and osteogenic differentiation of rBMSCs. Dopamine did not, however, interfere with the apoptosis and proliferation of rBMSCs. Interestingly, dopamine suppressed the osteogenic differentiation of rBMSCs, as characterized by reduced ALP staining, ALP activity, mineralized nodule formation, and the mRNA and protein levels of osteogenesis-related genes (Col1a1, Alp, Runx2, Opn, and Ocn). Furthermore, dopamine inactivated AKT/GSK-3β/β-catenin signaling pathway. Treatment of LiCl (GSK-3β inhibitor) rescued the inhibitory effects of dopamine on osteogenic differentiation of rBMSCs. LY294002 (AKT inhibitor) administration exacerbated the inhibitory effects of dopamine on osteogenic differentiation of rBMSCs. Taken together, these findings indicate that dopamine suppresses osteogenic differentiation of rBMSCs via AKT/GSK-3β/β-catenin signaling pathway. Our study provides new insights into the role of neurotransmitters in bone homeostasis. Hindawi 2022-06-29 /pmc/articles/PMC9259353/ /pubmed/35813889 http://dx.doi.org/10.1155/2022/4154440 Text en Copyright © 2022 Zhili Kuang et al. https://creativecommons.org/licenses/by/4.0/This is an open access article distributed under the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited.
spellingShingle Research Article
Kuang, Zhili
Chen, Zheng
Tu, Shaoqin
Mai, Zhihui
Chen, Lin
Kang, Xiaoning
Chen, Xiaochuan
Wei, Jiaming
Wang, Yuxuan
Peng, Yun
Ai, Hong
Dopamine Suppresses Osteogenic Differentiation of Rat Bone Marrow-Derived Mesenchymal Stem Cells via AKT/GSK-3β/β-Catenin Signaling Pathway
title Dopamine Suppresses Osteogenic Differentiation of Rat Bone Marrow-Derived Mesenchymal Stem Cells via AKT/GSK-3β/β-Catenin Signaling Pathway
title_full Dopamine Suppresses Osteogenic Differentiation of Rat Bone Marrow-Derived Mesenchymal Stem Cells via AKT/GSK-3β/β-Catenin Signaling Pathway
title_fullStr Dopamine Suppresses Osteogenic Differentiation of Rat Bone Marrow-Derived Mesenchymal Stem Cells via AKT/GSK-3β/β-Catenin Signaling Pathway
title_full_unstemmed Dopamine Suppresses Osteogenic Differentiation of Rat Bone Marrow-Derived Mesenchymal Stem Cells via AKT/GSK-3β/β-Catenin Signaling Pathway
title_short Dopamine Suppresses Osteogenic Differentiation of Rat Bone Marrow-Derived Mesenchymal Stem Cells via AKT/GSK-3β/β-Catenin Signaling Pathway
title_sort dopamine suppresses osteogenic differentiation of rat bone marrow-derived mesenchymal stem cells via akt/gsk-3β/β-catenin signaling pathway
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9259353/
https://www.ncbi.nlm.nih.gov/pubmed/35813889
http://dx.doi.org/10.1155/2022/4154440
work_keys_str_mv AT kuangzhili dopaminesuppressesosteogenicdifferentiationofratbonemarrowderivedmesenchymalstemcellsviaaktgsk3bbcateninsignalingpathway
AT chenzheng dopaminesuppressesosteogenicdifferentiationofratbonemarrowderivedmesenchymalstemcellsviaaktgsk3bbcateninsignalingpathway
AT tushaoqin dopaminesuppressesosteogenicdifferentiationofratbonemarrowderivedmesenchymalstemcellsviaaktgsk3bbcateninsignalingpathway
AT maizhihui dopaminesuppressesosteogenicdifferentiationofratbonemarrowderivedmesenchymalstemcellsviaaktgsk3bbcateninsignalingpathway
AT chenlin dopaminesuppressesosteogenicdifferentiationofratbonemarrowderivedmesenchymalstemcellsviaaktgsk3bbcateninsignalingpathway
AT kangxiaoning dopaminesuppressesosteogenicdifferentiationofratbonemarrowderivedmesenchymalstemcellsviaaktgsk3bbcateninsignalingpathway
AT chenxiaochuan dopaminesuppressesosteogenicdifferentiationofratbonemarrowderivedmesenchymalstemcellsviaaktgsk3bbcateninsignalingpathway
AT weijiaming dopaminesuppressesosteogenicdifferentiationofratbonemarrowderivedmesenchymalstemcellsviaaktgsk3bbcateninsignalingpathway
AT wangyuxuan dopaminesuppressesosteogenicdifferentiationofratbonemarrowderivedmesenchymalstemcellsviaaktgsk3bbcateninsignalingpathway
AT pengyun dopaminesuppressesosteogenicdifferentiationofratbonemarrowderivedmesenchymalstemcellsviaaktgsk3bbcateninsignalingpathway
AT aihong dopaminesuppressesosteogenicdifferentiationofratbonemarrowderivedmesenchymalstemcellsviaaktgsk3bbcateninsignalingpathway