Cargando…

Diabetes Detection and Management through Photoplethysmographic and Electrocardiographic Signals Analysis: A Systematic Review

(1) Background: Diabetes mellitus (DM) is a chronic, metabolic disease characterized by elevated levels of blood glucose. Recently, some studies approached the diabetes care domain through the analysis of the modifications of cardiovascular system parameters. In fact, cardiovascular diseases are the...

Descripción completa

Detalles Bibliográficos
Autores principales: Zanelli, Serena, Ammi, Mehdi, Hallab, Magid, El Yacoubi, Mounim A.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: MDPI 2022
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9269150/
https://www.ncbi.nlm.nih.gov/pubmed/35808386
http://dx.doi.org/10.3390/s22134890
_version_ 1784744162620342272
author Zanelli, Serena
Ammi, Mehdi
Hallab, Magid
El Yacoubi, Mounim A.
author_facet Zanelli, Serena
Ammi, Mehdi
Hallab, Magid
El Yacoubi, Mounim A.
author_sort Zanelli, Serena
collection PubMed
description (1) Background: Diabetes mellitus (DM) is a chronic, metabolic disease characterized by elevated levels of blood glucose. Recently, some studies approached the diabetes care domain through the analysis of the modifications of cardiovascular system parameters. In fact, cardiovascular diseases are the first leading cause of death in diabetic subjects. Thanks to their cost effectiveness and their ease of use, electrocardiographic (ECG) and photoplethysmographic (PPG) signals have recently been used in diabetes detection, blood glucose estimation and diabetes-related complication detection. This review’s aim is to provide a detailed overview of all the published methods, from the traditional (non machine learning) to the deep learning approaches, to detect and manage diabetes using PPG and ECG signals. This review will allow researchers to compare and understand the differences, in terms of results, amount of data and complexity that each type of approach provides and requires. (2) Method: We performed a systematic review based on articles that focus on the use of ECG and PPG signals in diabetes care. The search was focused on keywords related to the topic, such as “Diabetes”, “ECG”, “PPG”, “Machine Learning”, etc. This was performed using databases, such as PubMed, Google Scholar, Semantic Scholar and IEEE Xplore. This review’s aim is to provide a detailed overview of all the published methods, from the traditional (non machine learning) to the deep learning approaches, to detect and manage diabetes using PPG and ECG signals. This review will allow researchers to compare and understand the differences, in terms of results, amount of data and complexity that each type of approach provides and requires. (3) Results: A total of 78 studies were included. The majority of the selected studies focused on blood glucose estimation (41) and diabetes detection (31). Only 7 studies focused on diabetes complications detection. We present these studies by approach: traditional, machine learning and deep learning approaches. (4) Conclusions: ECG and PPG analysis in diabetes care showed to be very promising. Clinical validation and data processing standardization need to be improved in order to employ these techniques in a clinical environment.
format Online
Article
Text
id pubmed-9269150
institution National Center for Biotechnology Information
language English
publishDate 2022
publisher MDPI
record_format MEDLINE/PubMed
spelling pubmed-92691502022-07-09 Diabetes Detection and Management through Photoplethysmographic and Electrocardiographic Signals Analysis: A Systematic Review Zanelli, Serena Ammi, Mehdi Hallab, Magid El Yacoubi, Mounim A. Sensors (Basel) Review (1) Background: Diabetes mellitus (DM) is a chronic, metabolic disease characterized by elevated levels of blood glucose. Recently, some studies approached the diabetes care domain through the analysis of the modifications of cardiovascular system parameters. In fact, cardiovascular diseases are the first leading cause of death in diabetic subjects. Thanks to their cost effectiveness and their ease of use, electrocardiographic (ECG) and photoplethysmographic (PPG) signals have recently been used in diabetes detection, blood glucose estimation and diabetes-related complication detection. This review’s aim is to provide a detailed overview of all the published methods, from the traditional (non machine learning) to the deep learning approaches, to detect and manage diabetes using PPG and ECG signals. This review will allow researchers to compare and understand the differences, in terms of results, amount of data and complexity that each type of approach provides and requires. (2) Method: We performed a systematic review based on articles that focus on the use of ECG and PPG signals in diabetes care. The search was focused on keywords related to the topic, such as “Diabetes”, “ECG”, “PPG”, “Machine Learning”, etc. This was performed using databases, such as PubMed, Google Scholar, Semantic Scholar and IEEE Xplore. This review’s aim is to provide a detailed overview of all the published methods, from the traditional (non machine learning) to the deep learning approaches, to detect and manage diabetes using PPG and ECG signals. This review will allow researchers to compare and understand the differences, in terms of results, amount of data and complexity that each type of approach provides and requires. (3) Results: A total of 78 studies were included. The majority of the selected studies focused on blood glucose estimation (41) and diabetes detection (31). Only 7 studies focused on diabetes complications detection. We present these studies by approach: traditional, machine learning and deep learning approaches. (4) Conclusions: ECG and PPG analysis in diabetes care showed to be very promising. Clinical validation and data processing standardization need to be improved in order to employ these techniques in a clinical environment. MDPI 2022-06-29 /pmc/articles/PMC9269150/ /pubmed/35808386 http://dx.doi.org/10.3390/s22134890 Text en © 2022 by the authors. https://creativecommons.org/licenses/by/4.0/Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
spellingShingle Review
Zanelli, Serena
Ammi, Mehdi
Hallab, Magid
El Yacoubi, Mounim A.
Diabetes Detection and Management through Photoplethysmographic and Electrocardiographic Signals Analysis: A Systematic Review
title Diabetes Detection and Management through Photoplethysmographic and Electrocardiographic Signals Analysis: A Systematic Review
title_full Diabetes Detection and Management through Photoplethysmographic and Electrocardiographic Signals Analysis: A Systematic Review
title_fullStr Diabetes Detection and Management through Photoplethysmographic and Electrocardiographic Signals Analysis: A Systematic Review
title_full_unstemmed Diabetes Detection and Management through Photoplethysmographic and Electrocardiographic Signals Analysis: A Systematic Review
title_short Diabetes Detection and Management through Photoplethysmographic and Electrocardiographic Signals Analysis: A Systematic Review
title_sort diabetes detection and management through photoplethysmographic and electrocardiographic signals analysis: a systematic review
topic Review
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9269150/
https://www.ncbi.nlm.nih.gov/pubmed/35808386
http://dx.doi.org/10.3390/s22134890
work_keys_str_mv AT zanelliserena diabetesdetectionandmanagementthroughphotoplethysmographicandelectrocardiographicsignalsanalysisasystematicreview
AT ammimehdi diabetesdetectionandmanagementthroughphotoplethysmographicandelectrocardiographicsignalsanalysisasystematicreview
AT hallabmagid diabetesdetectionandmanagementthroughphotoplethysmographicandelectrocardiographicsignalsanalysisasystematicreview
AT elyacoubimounima diabetesdetectionandmanagementthroughphotoplethysmographicandelectrocardiographicsignalsanalysisasystematicreview