Cargando…
Pathogenic variants of PROC gene caused type II activity deficiency in a Chinese family: A case report
RATIONALE: Hereditary Protein C (PC) deficiency is a rare genetic disorder caused by PROC gene mutation. In this article, we report a case of PC deficiency in a Chinese family due to a novel PROC gene mutation. STUDY SUBJECT: The proband presented with recurrent cerebral infarction over the course o...
Autores principales: | , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Lippincott Williams & Wilkins
2021
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9282035/ https://www.ncbi.nlm.nih.gov/pubmed/33761690 http://dx.doi.org/10.1097/MD.0000000000025160 |
_version_ | 1784747017796321280 |
---|---|
author | Zhu, Hui Liu, Hongchao Liu, Jingyao |
author_facet | Zhu, Hui Liu, Hongchao Liu, Jingyao |
author_sort | Zhu, Hui |
collection | PubMed |
description | RATIONALE: Hereditary Protein C (PC) deficiency is a rare genetic disorder caused by PROC gene mutation. In this article, we report a case of PC deficiency in a Chinese family due to a novel PROC gene mutation. STUDY SUBJECT: The proband presented with recurrent cerebral infarction over the course of the previous 3 years. He was admitted to the hospital due to signs of mental retardation. DIAGNOSES: Physical examination, laboratory tests, and magnetic resonance imaging demonstrated that the proband had a manifestation of PC deficiency that included acute cerebral infarction. DNA sequencing analysis revealed a missense variant, c.1015G > A (p.V339 M from valine to methionine) in exon 9 of the PROC gene. In addition, Sanger sequencing confirmed that the proband's son was heterozygous for the same variant. Therefore, the PROC gene mutation was transmitted in an autosomal dominant inheritance manner. INTERVENTIONS: The patient was treated with a daily dosage of Warfarin (3.5 mg) and was scheduled to undergo regular blood coagulation tests. OUTCOMES: At the 3-month follow-up appointment, the patient showed improvements in his overall health condition. LESSONS: We identified a novel missense mutation in the PROC gene in a Chinese family which caused a decrease in the PC antigen level and recurrent cerebral infarction. |
format | Online Article Text |
id | pubmed-9282035 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2021 |
publisher | Lippincott Williams & Wilkins |
record_format | MEDLINE/PubMed |
spelling | pubmed-92820352022-08-02 Pathogenic variants of PROC gene caused type II activity deficiency in a Chinese family: A case report Zhu, Hui Liu, Hongchao Liu, Jingyao Medicine (Baltimore) 5300 RATIONALE: Hereditary Protein C (PC) deficiency is a rare genetic disorder caused by PROC gene mutation. In this article, we report a case of PC deficiency in a Chinese family due to a novel PROC gene mutation. STUDY SUBJECT: The proband presented with recurrent cerebral infarction over the course of the previous 3 years. He was admitted to the hospital due to signs of mental retardation. DIAGNOSES: Physical examination, laboratory tests, and magnetic resonance imaging demonstrated that the proband had a manifestation of PC deficiency that included acute cerebral infarction. DNA sequencing analysis revealed a missense variant, c.1015G > A (p.V339 M from valine to methionine) in exon 9 of the PROC gene. In addition, Sanger sequencing confirmed that the proband's son was heterozygous for the same variant. Therefore, the PROC gene mutation was transmitted in an autosomal dominant inheritance manner. INTERVENTIONS: The patient was treated with a daily dosage of Warfarin (3.5 mg) and was scheduled to undergo regular blood coagulation tests. OUTCOMES: At the 3-month follow-up appointment, the patient showed improvements in his overall health condition. LESSONS: We identified a novel missense mutation in the PROC gene in a Chinese family which caused a decrease in the PC antigen level and recurrent cerebral infarction. Lippincott Williams & Wilkins 2021-03-26 /pmc/articles/PMC9282035/ /pubmed/33761690 http://dx.doi.org/10.1097/MD.0000000000025160 Text en Copyright © 2021 the Author(s). Published by Wolters Kluwer Health, Inc. https://creativecommons.org/licenses/by/4.0/This is an open access article distributed under the Creative Commons Attribution License 4.0 (CCBY), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. http://creativecommons.org/licenses/by/4.0 (https://creativecommons.org/licenses/by/4.0/) |
spellingShingle | 5300 Zhu, Hui Liu, Hongchao Liu, Jingyao Pathogenic variants of PROC gene caused type II activity deficiency in a Chinese family: A case report |
title | Pathogenic variants of PROC gene caused type II activity deficiency in a Chinese family: A case report |
title_full | Pathogenic variants of PROC gene caused type II activity deficiency in a Chinese family: A case report |
title_fullStr | Pathogenic variants of PROC gene caused type II activity deficiency in a Chinese family: A case report |
title_full_unstemmed | Pathogenic variants of PROC gene caused type II activity deficiency in a Chinese family: A case report |
title_short | Pathogenic variants of PROC gene caused type II activity deficiency in a Chinese family: A case report |
title_sort | pathogenic variants of proc gene caused type ii activity deficiency in a chinese family: a case report |
topic | 5300 |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9282035/ https://www.ncbi.nlm.nih.gov/pubmed/33761690 http://dx.doi.org/10.1097/MD.0000000000025160 |
work_keys_str_mv | AT zhuhui pathogenicvariantsofprocgenecausedtypeiiactivitydeficiencyinachinesefamilyacasereport AT liuhongchao pathogenicvariantsofprocgenecausedtypeiiactivitydeficiencyinachinesefamilyacasereport AT liujingyao pathogenicvariantsofprocgenecausedtypeiiactivitydeficiencyinachinesefamilyacasereport |