Cargando…
The Clinical Utility of Soluble Serum Biomarkers in Autoimmune Pancreatitis: A Systematic Review
Autoimmune pancreatitis (AIP) is a rare etiological type of chronic pancreatitis. The clinical and radiological presentation of AIP often resembles that of pancreatic cancer. Identifying non-invasive markers for their early distinction is of utmost importance to avoid unnecessary surgery or a delay...
Autores principales: | , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
MDPI
2022
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9312496/ https://www.ncbi.nlm.nih.gov/pubmed/35884816 http://dx.doi.org/10.3390/biomedicines10071511 |
_version_ | 1784753855096946688 |
---|---|
author | Dugic, Ana Verdejo Gil, Cristina Mellenthin, Claudia Vujasinovic, Miroslav Löhr, J.-Matthias Mühldorfer, Steffen |
author_facet | Dugic, Ana Verdejo Gil, Cristina Mellenthin, Claudia Vujasinovic, Miroslav Löhr, J.-Matthias Mühldorfer, Steffen |
author_sort | Dugic, Ana |
collection | PubMed |
description | Autoimmune pancreatitis (AIP) is a rare etiological type of chronic pancreatitis. The clinical and radiological presentation of AIP often resembles that of pancreatic cancer. Identifying non-invasive markers for their early distinction is of utmost importance to avoid unnecessary surgery or a delay in steroid therapy. Thus, this systematic review was conducted to revisit all current evidence on the clinical utility of different serum biomarkers in diagnosing AIP, distinguishing AIP from pancreatic cancer, and predicting disease course, steroid therapy response, and relapse. A systematic review was performed for articles published up to August 2021 by searching electronic databases such as MEDLINE, Web of Science, and EMBASE. Among 5123 identified records, 92 studies were included in the qualitative synthesis. Apart from immunoglobulin (Ig) G4, which was by far the most studied biomarker, we identified autoantibodies against the following: lactoferrin, carboanhydrase II, plasminogen-binding protein, amylase-α2A, cationic (PRSS1) and anionic (PRSS2) trypsinogens, pancreatic secretory trypsin inhibitor (PSTI/SPINK1), and type IV collagen. The identified novel autoantigens were laminin 511, annexin A11, HSP-10, and prohibitin. Other biomarkers included cytokines, decreased complement levels, circulating immune complexes, N-glycan profile changes, aberrant miRNAs expression, decreased IgA and IgM levels, increased IgE levels and/or peripheral eosinophil count, and changes in apolipoprotein isoforms levels. To our knowledge, this is the first systematic review that addresses biomarkers in AIP. Evolving research has recognized numerous biomarkers that could help elucidate the pathophysiological mechanisms of AIP, bringing us closer to AIP diagnosis and its preoperative distinction from pancreatic cancer. |
format | Online Article Text |
id | pubmed-9312496 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2022 |
publisher | MDPI |
record_format | MEDLINE/PubMed |
spelling | pubmed-93124962022-07-26 The Clinical Utility of Soluble Serum Biomarkers in Autoimmune Pancreatitis: A Systematic Review Dugic, Ana Verdejo Gil, Cristina Mellenthin, Claudia Vujasinovic, Miroslav Löhr, J.-Matthias Mühldorfer, Steffen Biomedicines Systematic Review Autoimmune pancreatitis (AIP) is a rare etiological type of chronic pancreatitis. The clinical and radiological presentation of AIP often resembles that of pancreatic cancer. Identifying non-invasive markers for their early distinction is of utmost importance to avoid unnecessary surgery or a delay in steroid therapy. Thus, this systematic review was conducted to revisit all current evidence on the clinical utility of different serum biomarkers in diagnosing AIP, distinguishing AIP from pancreatic cancer, and predicting disease course, steroid therapy response, and relapse. A systematic review was performed for articles published up to August 2021 by searching electronic databases such as MEDLINE, Web of Science, and EMBASE. Among 5123 identified records, 92 studies were included in the qualitative synthesis. Apart from immunoglobulin (Ig) G4, which was by far the most studied biomarker, we identified autoantibodies against the following: lactoferrin, carboanhydrase II, plasminogen-binding protein, amylase-α2A, cationic (PRSS1) and anionic (PRSS2) trypsinogens, pancreatic secretory trypsin inhibitor (PSTI/SPINK1), and type IV collagen. The identified novel autoantigens were laminin 511, annexin A11, HSP-10, and prohibitin. Other biomarkers included cytokines, decreased complement levels, circulating immune complexes, N-glycan profile changes, aberrant miRNAs expression, decreased IgA and IgM levels, increased IgE levels and/or peripheral eosinophil count, and changes in apolipoprotein isoforms levels. To our knowledge, this is the first systematic review that addresses biomarkers in AIP. Evolving research has recognized numerous biomarkers that could help elucidate the pathophysiological mechanisms of AIP, bringing us closer to AIP diagnosis and its preoperative distinction from pancreatic cancer. MDPI 2022-06-26 /pmc/articles/PMC9312496/ /pubmed/35884816 http://dx.doi.org/10.3390/biomedicines10071511 Text en © 2022 by the authors. https://creativecommons.org/licenses/by/4.0/Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/). |
spellingShingle | Systematic Review Dugic, Ana Verdejo Gil, Cristina Mellenthin, Claudia Vujasinovic, Miroslav Löhr, J.-Matthias Mühldorfer, Steffen The Clinical Utility of Soluble Serum Biomarkers in Autoimmune Pancreatitis: A Systematic Review |
title | The Clinical Utility of Soluble Serum Biomarkers in Autoimmune Pancreatitis: A Systematic Review |
title_full | The Clinical Utility of Soluble Serum Biomarkers in Autoimmune Pancreatitis: A Systematic Review |
title_fullStr | The Clinical Utility of Soluble Serum Biomarkers in Autoimmune Pancreatitis: A Systematic Review |
title_full_unstemmed | The Clinical Utility of Soluble Serum Biomarkers in Autoimmune Pancreatitis: A Systematic Review |
title_short | The Clinical Utility of Soluble Serum Biomarkers in Autoimmune Pancreatitis: A Systematic Review |
title_sort | clinical utility of soluble serum biomarkers in autoimmune pancreatitis: a systematic review |
topic | Systematic Review |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9312496/ https://www.ncbi.nlm.nih.gov/pubmed/35884816 http://dx.doi.org/10.3390/biomedicines10071511 |
work_keys_str_mv | AT dugicana theclinicalutilityofsolubleserumbiomarkersinautoimmunepancreatitisasystematicreview AT verdejogilcristina theclinicalutilityofsolubleserumbiomarkersinautoimmunepancreatitisasystematicreview AT mellenthinclaudia theclinicalutilityofsolubleserumbiomarkersinautoimmunepancreatitisasystematicreview AT vujasinovicmiroslav theclinicalutilityofsolubleserumbiomarkersinautoimmunepancreatitisasystematicreview AT lohrjmatthias theclinicalutilityofsolubleserumbiomarkersinautoimmunepancreatitisasystematicreview AT muhldorfersteffen theclinicalutilityofsolubleserumbiomarkersinautoimmunepancreatitisasystematicreview AT dugicana clinicalutilityofsolubleserumbiomarkersinautoimmunepancreatitisasystematicreview AT verdejogilcristina clinicalutilityofsolubleserumbiomarkersinautoimmunepancreatitisasystematicreview AT mellenthinclaudia clinicalutilityofsolubleserumbiomarkersinautoimmunepancreatitisasystematicreview AT vujasinovicmiroslav clinicalutilityofsolubleserumbiomarkersinautoimmunepancreatitisasystematicreview AT lohrjmatthias clinicalutilityofsolubleserumbiomarkersinautoimmunepancreatitisasystematicreview AT muhldorfersteffen clinicalutilityofsolubleserumbiomarkersinautoimmunepancreatitisasystematicreview |