Cargando…

The Clinical Utility of Soluble Serum Biomarkers in Autoimmune Pancreatitis: A Systematic Review

Autoimmune pancreatitis (AIP) is a rare etiological type of chronic pancreatitis. The clinical and radiological presentation of AIP often resembles that of pancreatic cancer. Identifying non-invasive markers for their early distinction is of utmost importance to avoid unnecessary surgery or a delay...

Descripción completa

Detalles Bibliográficos
Autores principales: Dugic, Ana, Verdejo Gil, Cristina, Mellenthin, Claudia, Vujasinovic, Miroslav, Löhr, J.-Matthias, Mühldorfer, Steffen
Formato: Online Artículo Texto
Lenguaje:English
Publicado: MDPI 2022
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9312496/
https://www.ncbi.nlm.nih.gov/pubmed/35884816
http://dx.doi.org/10.3390/biomedicines10071511
_version_ 1784753855096946688
author Dugic, Ana
Verdejo Gil, Cristina
Mellenthin, Claudia
Vujasinovic, Miroslav
Löhr, J.-Matthias
Mühldorfer, Steffen
author_facet Dugic, Ana
Verdejo Gil, Cristina
Mellenthin, Claudia
Vujasinovic, Miroslav
Löhr, J.-Matthias
Mühldorfer, Steffen
author_sort Dugic, Ana
collection PubMed
description Autoimmune pancreatitis (AIP) is a rare etiological type of chronic pancreatitis. The clinical and radiological presentation of AIP often resembles that of pancreatic cancer. Identifying non-invasive markers for their early distinction is of utmost importance to avoid unnecessary surgery or a delay in steroid therapy. Thus, this systematic review was conducted to revisit all current evidence on the clinical utility of different serum biomarkers in diagnosing AIP, distinguishing AIP from pancreatic cancer, and predicting disease course, steroid therapy response, and relapse. A systematic review was performed for articles published up to August 2021 by searching electronic databases such as MEDLINE, Web of Science, and EMBASE. Among 5123 identified records, 92 studies were included in the qualitative synthesis. Apart from immunoglobulin (Ig) G4, which was by far the most studied biomarker, we identified autoantibodies against the following: lactoferrin, carboanhydrase II, plasminogen-binding protein, amylase-α2A, cationic (PRSS1) and anionic (PRSS2) trypsinogens, pancreatic secretory trypsin inhibitor (PSTI/SPINK1), and type IV collagen. The identified novel autoantigens were laminin 511, annexin A11, HSP-10, and prohibitin. Other biomarkers included cytokines, decreased complement levels, circulating immune complexes, N-glycan profile changes, aberrant miRNAs expression, decreased IgA and IgM levels, increased IgE levels and/or peripheral eosinophil count, and changes in apolipoprotein isoforms levels. To our knowledge, this is the first systematic review that addresses biomarkers in AIP. Evolving research has recognized numerous biomarkers that could help elucidate the pathophysiological mechanisms of AIP, bringing us closer to AIP diagnosis and its preoperative distinction from pancreatic cancer.
format Online
Article
Text
id pubmed-9312496
institution National Center for Biotechnology Information
language English
publishDate 2022
publisher MDPI
record_format MEDLINE/PubMed
spelling pubmed-93124962022-07-26 The Clinical Utility of Soluble Serum Biomarkers in Autoimmune Pancreatitis: A Systematic Review Dugic, Ana Verdejo Gil, Cristina Mellenthin, Claudia Vujasinovic, Miroslav Löhr, J.-Matthias Mühldorfer, Steffen Biomedicines Systematic Review Autoimmune pancreatitis (AIP) is a rare etiological type of chronic pancreatitis. The clinical and radiological presentation of AIP often resembles that of pancreatic cancer. Identifying non-invasive markers for their early distinction is of utmost importance to avoid unnecessary surgery or a delay in steroid therapy. Thus, this systematic review was conducted to revisit all current evidence on the clinical utility of different serum biomarkers in diagnosing AIP, distinguishing AIP from pancreatic cancer, and predicting disease course, steroid therapy response, and relapse. A systematic review was performed for articles published up to August 2021 by searching electronic databases such as MEDLINE, Web of Science, and EMBASE. Among 5123 identified records, 92 studies were included in the qualitative synthesis. Apart from immunoglobulin (Ig) G4, which was by far the most studied biomarker, we identified autoantibodies against the following: lactoferrin, carboanhydrase II, plasminogen-binding protein, amylase-α2A, cationic (PRSS1) and anionic (PRSS2) trypsinogens, pancreatic secretory trypsin inhibitor (PSTI/SPINK1), and type IV collagen. The identified novel autoantigens were laminin 511, annexin A11, HSP-10, and prohibitin. Other biomarkers included cytokines, decreased complement levels, circulating immune complexes, N-glycan profile changes, aberrant miRNAs expression, decreased IgA and IgM levels, increased IgE levels and/or peripheral eosinophil count, and changes in apolipoprotein isoforms levels. To our knowledge, this is the first systematic review that addresses biomarkers in AIP. Evolving research has recognized numerous biomarkers that could help elucidate the pathophysiological mechanisms of AIP, bringing us closer to AIP diagnosis and its preoperative distinction from pancreatic cancer. MDPI 2022-06-26 /pmc/articles/PMC9312496/ /pubmed/35884816 http://dx.doi.org/10.3390/biomedicines10071511 Text en © 2022 by the authors. https://creativecommons.org/licenses/by/4.0/Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
spellingShingle Systematic Review
Dugic, Ana
Verdejo Gil, Cristina
Mellenthin, Claudia
Vujasinovic, Miroslav
Löhr, J.-Matthias
Mühldorfer, Steffen
The Clinical Utility of Soluble Serum Biomarkers in Autoimmune Pancreatitis: A Systematic Review
title The Clinical Utility of Soluble Serum Biomarkers in Autoimmune Pancreatitis: A Systematic Review
title_full The Clinical Utility of Soluble Serum Biomarkers in Autoimmune Pancreatitis: A Systematic Review
title_fullStr The Clinical Utility of Soluble Serum Biomarkers in Autoimmune Pancreatitis: A Systematic Review
title_full_unstemmed The Clinical Utility of Soluble Serum Biomarkers in Autoimmune Pancreatitis: A Systematic Review
title_short The Clinical Utility of Soluble Serum Biomarkers in Autoimmune Pancreatitis: A Systematic Review
title_sort clinical utility of soluble serum biomarkers in autoimmune pancreatitis: a systematic review
topic Systematic Review
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9312496/
https://www.ncbi.nlm.nih.gov/pubmed/35884816
http://dx.doi.org/10.3390/biomedicines10071511
work_keys_str_mv AT dugicana theclinicalutilityofsolubleserumbiomarkersinautoimmunepancreatitisasystematicreview
AT verdejogilcristina theclinicalutilityofsolubleserumbiomarkersinautoimmunepancreatitisasystematicreview
AT mellenthinclaudia theclinicalutilityofsolubleserumbiomarkersinautoimmunepancreatitisasystematicreview
AT vujasinovicmiroslav theclinicalutilityofsolubleserumbiomarkersinautoimmunepancreatitisasystematicreview
AT lohrjmatthias theclinicalutilityofsolubleserumbiomarkersinautoimmunepancreatitisasystematicreview
AT muhldorfersteffen theclinicalutilityofsolubleserumbiomarkersinautoimmunepancreatitisasystematicreview
AT dugicana clinicalutilityofsolubleserumbiomarkersinautoimmunepancreatitisasystematicreview
AT verdejogilcristina clinicalutilityofsolubleserumbiomarkersinautoimmunepancreatitisasystematicreview
AT mellenthinclaudia clinicalutilityofsolubleserumbiomarkersinautoimmunepancreatitisasystematicreview
AT vujasinovicmiroslav clinicalutilityofsolubleserumbiomarkersinautoimmunepancreatitisasystematicreview
AT lohrjmatthias clinicalutilityofsolubleserumbiomarkersinautoimmunepancreatitisasystematicreview
AT muhldorfersteffen clinicalutilityofsolubleserumbiomarkersinautoimmunepancreatitisasystematicreview