Cargando…
A retrospective cross sectional study assessing factors associated with retention and non-viral suppression among HIV positive FSWs receiving antiretroviral therapy from primary health care facilities in Kampala, Uganda
BACKGROUND: Patient retention in care and sustained viral load suppression are a cornerstone to improved health and quality of life, among people living with HIV. However, challenges of retention on ART remain among female sex workers (FSWs). We report lost to follow up (LTFU), viral load suppressio...
Autores principales: | , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2022
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9315841/ https://www.ncbi.nlm.nih.gov/pubmed/35883042 http://dx.doi.org/10.1186/s12879-022-07614-w |
_version_ | 1784754661331304448 |
---|---|
author | Atuhaire, Lydia Shumba, Constance S. Mapahla, Lovemore Nyasulu, Peter S. |
author_facet | Atuhaire, Lydia Shumba, Constance S. Mapahla, Lovemore Nyasulu, Peter S. |
author_sort | Atuhaire, Lydia |
collection | PubMed |
description | BACKGROUND: Patient retention in care and sustained viral load suppression are a cornerstone to improved health and quality of life, among people living with HIV. However, challenges of retention on ART remain among female sex workers (FSWs). We report lost to follow up (LTFU), viral load suppression, and the associated factors among FSWs that access HIV treatment at primary health care facilities in Kampala. METHODS: We retrospectively abstracted and analysed patient management data of HIV positive FSWs who enrolled in care between January 2018 to December 2020. LTFU was defined as failure of a FSW to return for treatment at least 90 days from the date of their last clinic appointment. We defined viral suppression as having a last viral load of ≤ 1000 copies/ml preceding data abstraction. Data were analysed using Stata 15.1 software. RESULTS: A total of 275 FSWs were included in our study sample. We found low retention of 85.1% (n = 234) at six months, corresponding to LTFU of 14.9 (n = 41) within the same period. Retention decreased with duration of being in care up to 73.5% (n = 202) at 24 months, and this translates to LTFU of 26.5% (n = 73). Viral load testing coverage was 62% (n = 132) and of these, 90.9% (n = 120) were virally suppressed. Factors associated with LTFU in univariable logistic regression; and viral load suppression in multivariable logistic regression models were; having a telephone contact (OR: 0.3, 95% CI: 0.1–0.9 p = 0.031), having enrolled in HIV care aged ≥ 35 years (OR: 0.5, 95% CI: 0.2–1.0 p = 0.048), (OR:0.03, 95%CI: 0.00–0.5, p = 0.016); and having good ART adherence (OR: 0.2, 95% CI: 0.1–0.5 p = 0.001), (OR:24.0, 95% CI: 3.7–153.4 p = 0.001) respectively. Having good ART adherence remained statistically significant (OR: 0.2, 95% CI: 0.08–0.53 p = 0.001) in multivariable logistic regression for LTFU. CONCLUSION: This study found low retention among HIV diagnosed FSWs in care. Viral load suppression was acceptable and comparable to that of the general population, however viral load coverage was low. Strategies that increase retention in care and access to viral load testing such as individual client centred care models are vital to improve retention and viral load coverage among FSWs. |
format | Online Article Text |
id | pubmed-9315841 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2022 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-93158412022-07-26 A retrospective cross sectional study assessing factors associated with retention and non-viral suppression among HIV positive FSWs receiving antiretroviral therapy from primary health care facilities in Kampala, Uganda Atuhaire, Lydia Shumba, Constance S. Mapahla, Lovemore Nyasulu, Peter S. BMC Infect Dis Research BACKGROUND: Patient retention in care and sustained viral load suppression are a cornerstone to improved health and quality of life, among people living with HIV. However, challenges of retention on ART remain among female sex workers (FSWs). We report lost to follow up (LTFU), viral load suppression, and the associated factors among FSWs that access HIV treatment at primary health care facilities in Kampala. METHODS: We retrospectively abstracted and analysed patient management data of HIV positive FSWs who enrolled in care between January 2018 to December 2020. LTFU was defined as failure of a FSW to return for treatment at least 90 days from the date of their last clinic appointment. We defined viral suppression as having a last viral load of ≤ 1000 copies/ml preceding data abstraction. Data were analysed using Stata 15.1 software. RESULTS: A total of 275 FSWs were included in our study sample. We found low retention of 85.1% (n = 234) at six months, corresponding to LTFU of 14.9 (n = 41) within the same period. Retention decreased with duration of being in care up to 73.5% (n = 202) at 24 months, and this translates to LTFU of 26.5% (n = 73). Viral load testing coverage was 62% (n = 132) and of these, 90.9% (n = 120) were virally suppressed. Factors associated with LTFU in univariable logistic regression; and viral load suppression in multivariable logistic regression models were; having a telephone contact (OR: 0.3, 95% CI: 0.1–0.9 p = 0.031), having enrolled in HIV care aged ≥ 35 years (OR: 0.5, 95% CI: 0.2–1.0 p = 0.048), (OR:0.03, 95%CI: 0.00–0.5, p = 0.016); and having good ART adherence (OR: 0.2, 95% CI: 0.1–0.5 p = 0.001), (OR:24.0, 95% CI: 3.7–153.4 p = 0.001) respectively. Having good ART adherence remained statistically significant (OR: 0.2, 95% CI: 0.08–0.53 p = 0.001) in multivariable logistic regression for LTFU. CONCLUSION: This study found low retention among HIV diagnosed FSWs in care. Viral load suppression was acceptable and comparable to that of the general population, however viral load coverage was low. Strategies that increase retention in care and access to viral load testing such as individual client centred care models are vital to improve retention and viral load coverage among FSWs. BioMed Central 2022-07-26 /pmc/articles/PMC9315841/ /pubmed/35883042 http://dx.doi.org/10.1186/s12879-022-07614-w Text en © The Author(s) 2022 https://creativecommons.org/licenses/by/4.0/Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data. |
spellingShingle | Research Atuhaire, Lydia Shumba, Constance S. Mapahla, Lovemore Nyasulu, Peter S. A retrospective cross sectional study assessing factors associated with retention and non-viral suppression among HIV positive FSWs receiving antiretroviral therapy from primary health care facilities in Kampala, Uganda |
title | A retrospective cross sectional study assessing factors associated with retention and non-viral suppression among HIV positive FSWs receiving antiretroviral therapy from primary health care facilities in Kampala, Uganda |
title_full | A retrospective cross sectional study assessing factors associated with retention and non-viral suppression among HIV positive FSWs receiving antiretroviral therapy from primary health care facilities in Kampala, Uganda |
title_fullStr | A retrospective cross sectional study assessing factors associated with retention and non-viral suppression among HIV positive FSWs receiving antiretroviral therapy from primary health care facilities in Kampala, Uganda |
title_full_unstemmed | A retrospective cross sectional study assessing factors associated with retention and non-viral suppression among HIV positive FSWs receiving antiretroviral therapy from primary health care facilities in Kampala, Uganda |
title_short | A retrospective cross sectional study assessing factors associated with retention and non-viral suppression among HIV positive FSWs receiving antiretroviral therapy from primary health care facilities in Kampala, Uganda |
title_sort | retrospective cross sectional study assessing factors associated with retention and non-viral suppression among hiv positive fsws receiving antiretroviral therapy from primary health care facilities in kampala, uganda |
topic | Research |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9315841/ https://www.ncbi.nlm.nih.gov/pubmed/35883042 http://dx.doi.org/10.1186/s12879-022-07614-w |
work_keys_str_mv | AT atuhairelydia aretrospectivecrosssectionalstudyassessingfactorsassociatedwithretentionandnonviralsuppressionamonghivpositivefswsreceivingantiretroviraltherapyfromprimaryhealthcarefacilitiesinkampalauganda AT shumbaconstances aretrospectivecrosssectionalstudyassessingfactorsassociatedwithretentionandnonviralsuppressionamonghivpositivefswsreceivingantiretroviraltherapyfromprimaryhealthcarefacilitiesinkampalauganda AT mapahlalovemore aretrospectivecrosssectionalstudyassessingfactorsassociatedwithretentionandnonviralsuppressionamonghivpositivefswsreceivingantiretroviraltherapyfromprimaryhealthcarefacilitiesinkampalauganda AT nyasulupeters aretrospectivecrosssectionalstudyassessingfactorsassociatedwithretentionandnonviralsuppressionamonghivpositivefswsreceivingantiretroviraltherapyfromprimaryhealthcarefacilitiesinkampalauganda AT atuhairelydia retrospectivecrosssectionalstudyassessingfactorsassociatedwithretentionandnonviralsuppressionamonghivpositivefswsreceivingantiretroviraltherapyfromprimaryhealthcarefacilitiesinkampalauganda AT shumbaconstances retrospectivecrosssectionalstudyassessingfactorsassociatedwithretentionandnonviralsuppressionamonghivpositivefswsreceivingantiretroviraltherapyfromprimaryhealthcarefacilitiesinkampalauganda AT mapahlalovemore retrospectivecrosssectionalstudyassessingfactorsassociatedwithretentionandnonviralsuppressionamonghivpositivefswsreceivingantiretroviraltherapyfromprimaryhealthcarefacilitiesinkampalauganda AT nyasulupeters retrospectivecrosssectionalstudyassessingfactorsassociatedwithretentionandnonviralsuppressionamonghivpositivefswsreceivingantiretroviraltherapyfromprimaryhealthcarefacilitiesinkampalauganda |