Cargando…

Preference and usage pattern of mobile medical apps for drug information purposes among hospital pharmacists in Sarawak, Malaysia

INTRODUCTION: Pharmacists are frequent users of mobile medical apps (MMA) for drug information (DI) and clinical decision-making purposes. However, the wide range of available MMA may be of variable credibility and results in heterogeneous recommendations. The need for subscription may also influenc...

Descripción completa

Detalles Bibliográficos
Autores principales: Kho, Boon Phiaw, Wong, Sheng Ming Andy, Chiu, Jin Wei Timothy, Liew, Eon
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2022
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9338490/
https://www.ncbi.nlm.nih.gov/pubmed/35906649
http://dx.doi.org/10.1186/s12911-022-01949-9
_version_ 1784759979020910592
author Kho, Boon Phiaw
Wong, Sheng Ming Andy
Chiu, Jin Wei Timothy
Liew, Eon
author_facet Kho, Boon Phiaw
Wong, Sheng Ming Andy
Chiu, Jin Wei Timothy
Liew, Eon
author_sort Kho, Boon Phiaw
collection PubMed
description INTRODUCTION: Pharmacists are frequent users of mobile medical apps (MMA) for drug information (DI) and clinical decision-making purposes. However, the wide range of available MMA may be of variable credibility and results in heterogeneous recommendations. The need for subscription may also influence choice of apps. OBJECTIVE: The objective of this study was to determine the usage pattern of MMA among hospital pharmacists, including their perceptions and factors affecting their choice of apps. METHODS: This cross-sectional study required respondents to fill in an online questionnaire. The questionnaire included sections on respondents' demographic data, MMA usage pattern, perceived usefulness and opinion on subscription fees. Items were adapted from available literature and validated locally. It was made accessible for 6 weeks starting November 2019 for all pharmacists working in the 23 public hospitals in Sarawak to response (universal sampling). Collected data were analysed using descriptive and inferential statistics. RESULTS: A response rate of 37.2% was achieved (n = 162). Respondents were heavily reliant on MMA, with 78.4% accessing them multiple times daily. The majority also agreed that MMA contain correct and up-to-date information. A median of 5 apps were downloaded, suggesting an ultimate app catering for all DI needs was lacking. The Malaysian Drug Formulary was the most downloaded app (88.3%), whereas Lexicomp® was the most “well-rounded” in terms of functionality. Clinical pharmacists were significantly more likely to purchase MMA, in particular UpToDate® (p < 0.01) due to their need to access clinical updates. Respondents highly recommended institutional access for either UpToDate® or Lexicomp® be made available. Pre-registration pharmacists should be guided on judicious MMA usage, as they downloaded significantly more apps and were more likely to indicate not knowing which DI recommendation to follow (both p < 0.01). CONCLUSION: MMA has become an indispensable tool for hospital pharmacists, however there was a tendency to download multiple apps for DI needs. Institutional access can be considered for credible apps identified to ensure accuracy and uniformity of DI recommendations, with purchase decision made after surveying the needs and preferences of end users. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12911-022-01949-9.
format Online
Article
Text
id pubmed-9338490
institution National Center for Biotechnology Information
language English
publishDate 2022
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-93384902022-07-31 Preference and usage pattern of mobile medical apps for drug information purposes among hospital pharmacists in Sarawak, Malaysia Kho, Boon Phiaw Wong, Sheng Ming Andy Chiu, Jin Wei Timothy Liew, Eon BMC Med Inform Decis Mak Research INTRODUCTION: Pharmacists are frequent users of mobile medical apps (MMA) for drug information (DI) and clinical decision-making purposes. However, the wide range of available MMA may be of variable credibility and results in heterogeneous recommendations. The need for subscription may also influence choice of apps. OBJECTIVE: The objective of this study was to determine the usage pattern of MMA among hospital pharmacists, including their perceptions and factors affecting their choice of apps. METHODS: This cross-sectional study required respondents to fill in an online questionnaire. The questionnaire included sections on respondents' demographic data, MMA usage pattern, perceived usefulness and opinion on subscription fees. Items were adapted from available literature and validated locally. It was made accessible for 6 weeks starting November 2019 for all pharmacists working in the 23 public hospitals in Sarawak to response (universal sampling). Collected data were analysed using descriptive and inferential statistics. RESULTS: A response rate of 37.2% was achieved (n = 162). Respondents were heavily reliant on MMA, with 78.4% accessing them multiple times daily. The majority also agreed that MMA contain correct and up-to-date information. A median of 5 apps were downloaded, suggesting an ultimate app catering for all DI needs was lacking. The Malaysian Drug Formulary was the most downloaded app (88.3%), whereas Lexicomp® was the most “well-rounded” in terms of functionality. Clinical pharmacists were significantly more likely to purchase MMA, in particular UpToDate® (p < 0.01) due to their need to access clinical updates. Respondents highly recommended institutional access for either UpToDate® or Lexicomp® be made available. Pre-registration pharmacists should be guided on judicious MMA usage, as they downloaded significantly more apps and were more likely to indicate not knowing which DI recommendation to follow (both p < 0.01). CONCLUSION: MMA has become an indispensable tool for hospital pharmacists, however there was a tendency to download multiple apps for DI needs. Institutional access can be considered for credible apps identified to ensure accuracy and uniformity of DI recommendations, with purchase decision made after surveying the needs and preferences of end users. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12911-022-01949-9. BioMed Central 2022-07-29 /pmc/articles/PMC9338490/ /pubmed/35906649 http://dx.doi.org/10.1186/s12911-022-01949-9 Text en © The Author(s) 2022 https://creativecommons.org/licenses/by/4.0/Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data.
spellingShingle Research
Kho, Boon Phiaw
Wong, Sheng Ming Andy
Chiu, Jin Wei Timothy
Liew, Eon
Preference and usage pattern of mobile medical apps for drug information purposes among hospital pharmacists in Sarawak, Malaysia
title Preference and usage pattern of mobile medical apps for drug information purposes among hospital pharmacists in Sarawak, Malaysia
title_full Preference and usage pattern of mobile medical apps for drug information purposes among hospital pharmacists in Sarawak, Malaysia
title_fullStr Preference and usage pattern of mobile medical apps for drug information purposes among hospital pharmacists in Sarawak, Malaysia
title_full_unstemmed Preference and usage pattern of mobile medical apps for drug information purposes among hospital pharmacists in Sarawak, Malaysia
title_short Preference and usage pattern of mobile medical apps for drug information purposes among hospital pharmacists in Sarawak, Malaysia
title_sort preference and usage pattern of mobile medical apps for drug information purposes among hospital pharmacists in sarawak, malaysia
topic Research
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9338490/
https://www.ncbi.nlm.nih.gov/pubmed/35906649
http://dx.doi.org/10.1186/s12911-022-01949-9
work_keys_str_mv AT khoboonphiaw preferenceandusagepatternofmobilemedicalappsfordruginformationpurposesamonghospitalpharmacistsinsarawakmalaysia
AT wongshengmingandy preferenceandusagepatternofmobilemedicalappsfordruginformationpurposesamonghospitalpharmacistsinsarawakmalaysia
AT chiujinweitimothy preferenceandusagepatternofmobilemedicalappsfordruginformationpurposesamonghospitalpharmacistsinsarawakmalaysia
AT lieweon preferenceandusagepatternofmobilemedicalappsfordruginformationpurposesamonghospitalpharmacistsinsarawakmalaysia