Cargando…
Hospitals during economic crisis: a systematic review based on resilience system capacities framework
BACKGROUND: Hospitals are the biggest users of the health system budgets. Policymakers are interested in improving hospital efficiency while maintaining their performance during the economic crisis. This study aims at analysing the hospitals’ policy solutions during the economic crisis using the res...
Autores principales: | , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2022
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9339182/ https://www.ncbi.nlm.nih.gov/pubmed/35907833 http://dx.doi.org/10.1186/s12913-022-08316-4 |
_version_ | 1784760137655779328 |
---|---|
author | Foroughi, Zeynab Ebrahimi, Parvin Aryankhesal, Aidin Maleki, Mohammadreza Yazdani, Shahram |
author_facet | Foroughi, Zeynab Ebrahimi, Parvin Aryankhesal, Aidin Maleki, Mohammadreza Yazdani, Shahram |
author_sort | Foroughi, Zeynab |
collection | PubMed |
description | BACKGROUND: Hospitals are the biggest users of the health system budgets. Policymakers are interested in improving hospital efficiency while maintaining their performance during the economic crisis. This study aims at analysing the hospitals’ policy solutions during the economic crisis using the resilience system capacities framework. METHOD: This study is a systematic review. The search strategy was implemented on the Web of Science, PubMed, Embase, Scopus databases, and Econbiz search portal. Data were extracted and analysed through the comparative table of resilience system capacities framework and the World Health Organization (WHO) health system’s six building blocks (i.e., leadership and governance, service delivery, health workforce, health systems financing, health information systems, and medicines and equipment). FINDINGS: After the screening, 78 studies across 36 countries were reviewed. The economic crisis and adopted policies had a destructive effect on hospital contribution in achieving Universal Health Coverage (UHC). The short-term absorptive capacity policies were the most frequent policies against the economic crisis. Moreover, the least frequent and most effective policies were adaptive policies. Transformative policies mainly focused on moving from hospital-based to integrated and community-based services. The strength of primary care and community-based services, types and combination of hospital financing systems, hospital performance before the crisis, hospital managers’ competencies, and regional, specialties, and ownership differences between hospitals can affect the nature and success of adopted policies. CONCLUSION: The focus of countries on short-term policies and undermining necessary contextual factors, prioritizing efficiency over quality, and ignoring the interrelation of policies compromised hospital contribution in UHC. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12913-022-08316-4. |
format | Online Article Text |
id | pubmed-9339182 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2022 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-93391822022-08-01 Hospitals during economic crisis: a systematic review based on resilience system capacities framework Foroughi, Zeynab Ebrahimi, Parvin Aryankhesal, Aidin Maleki, Mohammadreza Yazdani, Shahram BMC Health Serv Res Research BACKGROUND: Hospitals are the biggest users of the health system budgets. Policymakers are interested in improving hospital efficiency while maintaining their performance during the economic crisis. This study aims at analysing the hospitals’ policy solutions during the economic crisis using the resilience system capacities framework. METHOD: This study is a systematic review. The search strategy was implemented on the Web of Science, PubMed, Embase, Scopus databases, and Econbiz search portal. Data were extracted and analysed through the comparative table of resilience system capacities framework and the World Health Organization (WHO) health system’s six building blocks (i.e., leadership and governance, service delivery, health workforce, health systems financing, health information systems, and medicines and equipment). FINDINGS: After the screening, 78 studies across 36 countries were reviewed. The economic crisis and adopted policies had a destructive effect on hospital contribution in achieving Universal Health Coverage (UHC). The short-term absorptive capacity policies were the most frequent policies against the economic crisis. Moreover, the least frequent and most effective policies were adaptive policies. Transformative policies mainly focused on moving from hospital-based to integrated and community-based services. The strength of primary care and community-based services, types and combination of hospital financing systems, hospital performance before the crisis, hospital managers’ competencies, and regional, specialties, and ownership differences between hospitals can affect the nature and success of adopted policies. CONCLUSION: The focus of countries on short-term policies and undermining necessary contextual factors, prioritizing efficiency over quality, and ignoring the interrelation of policies compromised hospital contribution in UHC. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12913-022-08316-4. BioMed Central 2022-07-30 /pmc/articles/PMC9339182/ /pubmed/35907833 http://dx.doi.org/10.1186/s12913-022-08316-4 Text en © The Author(s) 2022 https://creativecommons.org/licenses/by/4.0/Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data. |
spellingShingle | Research Foroughi, Zeynab Ebrahimi, Parvin Aryankhesal, Aidin Maleki, Mohammadreza Yazdani, Shahram Hospitals during economic crisis: a systematic review based on resilience system capacities framework |
title | Hospitals during economic crisis: a systematic review based on resilience system capacities framework |
title_full | Hospitals during economic crisis: a systematic review based on resilience system capacities framework |
title_fullStr | Hospitals during economic crisis: a systematic review based on resilience system capacities framework |
title_full_unstemmed | Hospitals during economic crisis: a systematic review based on resilience system capacities framework |
title_short | Hospitals during economic crisis: a systematic review based on resilience system capacities framework |
title_sort | hospitals during economic crisis: a systematic review based on resilience system capacities framework |
topic | Research |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9339182/ https://www.ncbi.nlm.nih.gov/pubmed/35907833 http://dx.doi.org/10.1186/s12913-022-08316-4 |
work_keys_str_mv | AT foroughizeynab hospitalsduringeconomiccrisisasystematicreviewbasedonresiliencesystemcapacitiesframework AT ebrahimiparvin hospitalsduringeconomiccrisisasystematicreviewbasedonresiliencesystemcapacitiesframework AT aryankhesalaidin hospitalsduringeconomiccrisisasystematicreviewbasedonresiliencesystemcapacitiesframework AT malekimohammadreza hospitalsduringeconomiccrisisasystematicreviewbasedonresiliencesystemcapacitiesframework AT yazdanishahram hospitalsduringeconomiccrisisasystematicreviewbasedonresiliencesystemcapacitiesframework |