Cargando…
The role of job aids in supporting task sharing family planning services to community pharmacists and patent proprietary medicine vendors in Kaduna and Lagos, Nigeria
BACKGROUND: CPs and PPMVs are an important source of modern contraceptives in Nigeria, yet many lack the requisite knowledge and skills to capably provide these services. This skills gap might be addressed through targeted family planning (FP) training. This study measures family planning knowledge...
Autores principales: | , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2022
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9340708/ https://www.ncbi.nlm.nih.gov/pubmed/35915491 http://dx.doi.org/10.1186/s12913-022-08360-0 |
_version_ | 1784760451912957952 |
---|---|
author | Baruwa, Sikiru Tobey, Elizabeth Okafor, Emeka Afolabi, Kayode Akomolafe, Toyin O. Ubuane, Innocent Anyanti, Jennifer Jain, Aparna |
author_facet | Baruwa, Sikiru Tobey, Elizabeth Okafor, Emeka Afolabi, Kayode Akomolafe, Toyin O. Ubuane, Innocent Anyanti, Jennifer Jain, Aparna |
author_sort | Baruwa, Sikiru |
collection | PubMed |
description | BACKGROUND: CPs and PPMVs are an important source of modern contraceptives in Nigeria, yet many lack the requisite knowledge and skills to capably provide these services. This skills gap might be addressed through targeted family planning (FP) training. This study measures family planning knowledge retention of CPs and PPMVs after receiving training in FP counseling and services in Kaduna and Lagos States, in Nigeria. METHODS: In a quasi-experimental longitudinal design without a comparison group, 559 CPs and PPMVs who were enrolled in the IntegratE project between January and December 2019, completed a self-administered questionnaire to assess their knowledge related to the provision of FP counseling, and injectable and implant contraceptive services at three points in time: 1) before the training; 2) immediately after the training; and 3) 9-months after the training in Kaduna and Lagos states, Nigeria. Adjusted multivariate logistic regression analysis was used to assess the effect of provider characteristics and receipt of job aids on FP knowledge retention 9 months after the training. 95% confidence intervals and p-values were used to assess statistical significance. RESULTS: Majority of study participants were females (60.3%) and between 30 and 49 years old (63.4%). The study revealed the importance of jobs aids as influence on knowledge retention. CPs and PPMVs who reported having the Balanced Counseling Strategy plus (BCS+) counseling cards, were more likely to retain knowledge (AOR: 2.92; 95% CI: 1.01–8.40, p-value = 0.05) at 9 months follow-up. Similarly, in terms of knowledge of injectable contraceptives, CPs and Tier 2 PPMVs who reported receiving the Medical Eligibility Criteria (MEC) Wheel were 2.1 times more likely to retain knowledge of injectable contraceptives 9-months later on (95% CI: 1.14–3.99, p-value = 0.02). CONCLUSION: Community Pharmacists and Proprietary Medicine Vendors had good retention of family planning knowledge, especially when combined with job aids. Training and providing them with job aids on FP will therefore support task shifting and task sharing on family planning services provision in Nigeria. |
format | Online Article Text |
id | pubmed-9340708 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2022 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-93407082022-08-01 The role of job aids in supporting task sharing family planning services to community pharmacists and patent proprietary medicine vendors in Kaduna and Lagos, Nigeria Baruwa, Sikiru Tobey, Elizabeth Okafor, Emeka Afolabi, Kayode Akomolafe, Toyin O. Ubuane, Innocent Anyanti, Jennifer Jain, Aparna BMC Health Serv Res Research BACKGROUND: CPs and PPMVs are an important source of modern contraceptives in Nigeria, yet many lack the requisite knowledge and skills to capably provide these services. This skills gap might be addressed through targeted family planning (FP) training. This study measures family planning knowledge retention of CPs and PPMVs after receiving training in FP counseling and services in Kaduna and Lagos States, in Nigeria. METHODS: In a quasi-experimental longitudinal design without a comparison group, 559 CPs and PPMVs who were enrolled in the IntegratE project between January and December 2019, completed a self-administered questionnaire to assess their knowledge related to the provision of FP counseling, and injectable and implant contraceptive services at three points in time: 1) before the training; 2) immediately after the training; and 3) 9-months after the training in Kaduna and Lagos states, Nigeria. Adjusted multivariate logistic regression analysis was used to assess the effect of provider characteristics and receipt of job aids on FP knowledge retention 9 months after the training. 95% confidence intervals and p-values were used to assess statistical significance. RESULTS: Majority of study participants were females (60.3%) and between 30 and 49 years old (63.4%). The study revealed the importance of jobs aids as influence on knowledge retention. CPs and PPMVs who reported having the Balanced Counseling Strategy plus (BCS+) counseling cards, were more likely to retain knowledge (AOR: 2.92; 95% CI: 1.01–8.40, p-value = 0.05) at 9 months follow-up. Similarly, in terms of knowledge of injectable contraceptives, CPs and Tier 2 PPMVs who reported receiving the Medical Eligibility Criteria (MEC) Wheel were 2.1 times more likely to retain knowledge of injectable contraceptives 9-months later on (95% CI: 1.14–3.99, p-value = 0.02). CONCLUSION: Community Pharmacists and Proprietary Medicine Vendors had good retention of family planning knowledge, especially when combined with job aids. Training and providing them with job aids on FP will therefore support task shifting and task sharing on family planning services provision in Nigeria. BioMed Central 2022-08-01 /pmc/articles/PMC9340708/ /pubmed/35915491 http://dx.doi.org/10.1186/s12913-022-08360-0 Text en © The Author(s) 2022 https://creativecommons.org/licenses/by/4.0/Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data. |
spellingShingle | Research Baruwa, Sikiru Tobey, Elizabeth Okafor, Emeka Afolabi, Kayode Akomolafe, Toyin O. Ubuane, Innocent Anyanti, Jennifer Jain, Aparna The role of job aids in supporting task sharing family planning services to community pharmacists and patent proprietary medicine vendors in Kaduna and Lagos, Nigeria |
title | The role of job aids in supporting task sharing family planning services to community pharmacists and patent proprietary medicine vendors in Kaduna and Lagos, Nigeria |
title_full | The role of job aids in supporting task sharing family planning services to community pharmacists and patent proprietary medicine vendors in Kaduna and Lagos, Nigeria |
title_fullStr | The role of job aids in supporting task sharing family planning services to community pharmacists and patent proprietary medicine vendors in Kaduna and Lagos, Nigeria |
title_full_unstemmed | The role of job aids in supporting task sharing family planning services to community pharmacists and patent proprietary medicine vendors in Kaduna and Lagos, Nigeria |
title_short | The role of job aids in supporting task sharing family planning services to community pharmacists and patent proprietary medicine vendors in Kaduna and Lagos, Nigeria |
title_sort | role of job aids in supporting task sharing family planning services to community pharmacists and patent proprietary medicine vendors in kaduna and lagos, nigeria |
topic | Research |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9340708/ https://www.ncbi.nlm.nih.gov/pubmed/35915491 http://dx.doi.org/10.1186/s12913-022-08360-0 |
work_keys_str_mv | AT baruwasikiru theroleofjobaidsinsupportingtasksharingfamilyplanningservicestocommunitypharmacistsandpatentproprietarymedicinevendorsinkadunaandlagosnigeria AT tobeyelizabeth theroleofjobaidsinsupportingtasksharingfamilyplanningservicestocommunitypharmacistsandpatentproprietarymedicinevendorsinkadunaandlagosnigeria AT okaforemeka theroleofjobaidsinsupportingtasksharingfamilyplanningservicestocommunitypharmacistsandpatentproprietarymedicinevendorsinkadunaandlagosnigeria AT afolabikayode theroleofjobaidsinsupportingtasksharingfamilyplanningservicestocommunitypharmacistsandpatentproprietarymedicinevendorsinkadunaandlagosnigeria AT akomolafetoyino theroleofjobaidsinsupportingtasksharingfamilyplanningservicestocommunitypharmacistsandpatentproprietarymedicinevendorsinkadunaandlagosnigeria AT ubuaneinnocent theroleofjobaidsinsupportingtasksharingfamilyplanningservicestocommunitypharmacistsandpatentproprietarymedicinevendorsinkadunaandlagosnigeria AT anyantijennifer theroleofjobaidsinsupportingtasksharingfamilyplanningservicestocommunitypharmacistsandpatentproprietarymedicinevendorsinkadunaandlagosnigeria AT jainaparna theroleofjobaidsinsupportingtasksharingfamilyplanningservicestocommunitypharmacistsandpatentproprietarymedicinevendorsinkadunaandlagosnigeria AT baruwasikiru roleofjobaidsinsupportingtasksharingfamilyplanningservicestocommunitypharmacistsandpatentproprietarymedicinevendorsinkadunaandlagosnigeria AT tobeyelizabeth roleofjobaidsinsupportingtasksharingfamilyplanningservicestocommunitypharmacistsandpatentproprietarymedicinevendorsinkadunaandlagosnigeria AT okaforemeka roleofjobaidsinsupportingtasksharingfamilyplanningservicestocommunitypharmacistsandpatentproprietarymedicinevendorsinkadunaandlagosnigeria AT afolabikayode roleofjobaidsinsupportingtasksharingfamilyplanningservicestocommunitypharmacistsandpatentproprietarymedicinevendorsinkadunaandlagosnigeria AT akomolafetoyino roleofjobaidsinsupportingtasksharingfamilyplanningservicestocommunitypharmacistsandpatentproprietarymedicinevendorsinkadunaandlagosnigeria AT ubuaneinnocent roleofjobaidsinsupportingtasksharingfamilyplanningservicestocommunitypharmacistsandpatentproprietarymedicinevendorsinkadunaandlagosnigeria AT anyantijennifer roleofjobaidsinsupportingtasksharingfamilyplanningservicestocommunitypharmacistsandpatentproprietarymedicinevendorsinkadunaandlagosnigeria AT jainaparna roleofjobaidsinsupportingtasksharingfamilyplanningservicestocommunitypharmacistsandpatentproprietarymedicinevendorsinkadunaandlagosnigeria |