Cargando…

The role of job aids in supporting task sharing family planning services to community pharmacists and patent proprietary medicine vendors in Kaduna and Lagos, Nigeria

BACKGROUND: CPs and PPMVs are an important source of modern contraceptives in Nigeria, yet many lack the requisite knowledge and skills to capably provide these services. This skills gap might be addressed through targeted family planning (FP) training. This study measures family planning knowledge...

Descripción completa

Detalles Bibliográficos
Autores principales: Baruwa, Sikiru, Tobey, Elizabeth, Okafor, Emeka, Afolabi, Kayode, Akomolafe, Toyin O., Ubuane, Innocent, Anyanti, Jennifer, Jain, Aparna
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2022
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9340708/
https://www.ncbi.nlm.nih.gov/pubmed/35915491
http://dx.doi.org/10.1186/s12913-022-08360-0
_version_ 1784760451912957952
author Baruwa, Sikiru
Tobey, Elizabeth
Okafor, Emeka
Afolabi, Kayode
Akomolafe, Toyin O.
Ubuane, Innocent
Anyanti, Jennifer
Jain, Aparna
author_facet Baruwa, Sikiru
Tobey, Elizabeth
Okafor, Emeka
Afolabi, Kayode
Akomolafe, Toyin O.
Ubuane, Innocent
Anyanti, Jennifer
Jain, Aparna
author_sort Baruwa, Sikiru
collection PubMed
description BACKGROUND: CPs and PPMVs are an important source of modern contraceptives in Nigeria, yet many lack the requisite knowledge and skills to capably provide these services. This skills gap might be addressed through targeted family planning (FP) training. This study measures family planning knowledge retention of CPs and PPMVs after receiving training in FP counseling and services in Kaduna and Lagos States, in Nigeria. METHODS: In a quasi-experimental longitudinal design without a comparison group, 559 CPs and PPMVs who were enrolled in the IntegratE project between January and December 2019, completed a self-administered questionnaire to assess their knowledge related to the provision of FP counseling, and injectable and implant contraceptive services at three points in time: 1) before the training; 2) immediately after the training; and 3) 9-months after the training in Kaduna and Lagos states, Nigeria. Adjusted multivariate logistic regression analysis was used to assess the effect of provider characteristics and receipt of job aids on FP knowledge retention 9 months after the training. 95% confidence intervals and p-values were used to assess statistical significance. RESULTS: Majority of study participants were females (60.3%) and between 30 and 49 years old (63.4%). The study revealed the importance of jobs aids as influence on knowledge retention. CPs and PPMVs who reported having the Balanced Counseling Strategy plus (BCS+) counseling cards, were more likely to retain knowledge (AOR: 2.92; 95% CI: 1.01–8.40, p-value = 0.05) at 9 months follow-up. Similarly, in terms of knowledge of injectable contraceptives, CPs and Tier 2 PPMVs who reported receiving the Medical Eligibility Criteria (MEC) Wheel were 2.1 times more likely to retain knowledge of injectable contraceptives 9-months later on (95% CI: 1.14–3.99, p-value = 0.02). CONCLUSION: Community Pharmacists and Proprietary Medicine Vendors had good retention of family planning knowledge, especially when combined with job aids. Training and providing them with job aids on FP will therefore support task shifting and task sharing on family planning services provision in Nigeria.
format Online
Article
Text
id pubmed-9340708
institution National Center for Biotechnology Information
language English
publishDate 2022
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-93407082022-08-01 The role of job aids in supporting task sharing family planning services to community pharmacists and patent proprietary medicine vendors in Kaduna and Lagos, Nigeria Baruwa, Sikiru Tobey, Elizabeth Okafor, Emeka Afolabi, Kayode Akomolafe, Toyin O. Ubuane, Innocent Anyanti, Jennifer Jain, Aparna BMC Health Serv Res Research BACKGROUND: CPs and PPMVs are an important source of modern contraceptives in Nigeria, yet many lack the requisite knowledge and skills to capably provide these services. This skills gap might be addressed through targeted family planning (FP) training. This study measures family planning knowledge retention of CPs and PPMVs after receiving training in FP counseling and services in Kaduna and Lagos States, in Nigeria. METHODS: In a quasi-experimental longitudinal design without a comparison group, 559 CPs and PPMVs who were enrolled in the IntegratE project between January and December 2019, completed a self-administered questionnaire to assess their knowledge related to the provision of FP counseling, and injectable and implant contraceptive services at three points in time: 1) before the training; 2) immediately after the training; and 3) 9-months after the training in Kaduna and Lagos states, Nigeria. Adjusted multivariate logistic regression analysis was used to assess the effect of provider characteristics and receipt of job aids on FP knowledge retention 9 months after the training. 95% confidence intervals and p-values were used to assess statistical significance. RESULTS: Majority of study participants were females (60.3%) and between 30 and 49 years old (63.4%). The study revealed the importance of jobs aids as influence on knowledge retention. CPs and PPMVs who reported having the Balanced Counseling Strategy plus (BCS+) counseling cards, were more likely to retain knowledge (AOR: 2.92; 95% CI: 1.01–8.40, p-value = 0.05) at 9 months follow-up. Similarly, in terms of knowledge of injectable contraceptives, CPs and Tier 2 PPMVs who reported receiving the Medical Eligibility Criteria (MEC) Wheel were 2.1 times more likely to retain knowledge of injectable contraceptives 9-months later on (95% CI: 1.14–3.99, p-value = 0.02). CONCLUSION: Community Pharmacists and Proprietary Medicine Vendors had good retention of family planning knowledge, especially when combined with job aids. Training and providing them with job aids on FP will therefore support task shifting and task sharing on family planning services provision in Nigeria. BioMed Central 2022-08-01 /pmc/articles/PMC9340708/ /pubmed/35915491 http://dx.doi.org/10.1186/s12913-022-08360-0 Text en © The Author(s) 2022 https://creativecommons.org/licenses/by/4.0/Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data.
spellingShingle Research
Baruwa, Sikiru
Tobey, Elizabeth
Okafor, Emeka
Afolabi, Kayode
Akomolafe, Toyin O.
Ubuane, Innocent
Anyanti, Jennifer
Jain, Aparna
The role of job aids in supporting task sharing family planning services to community pharmacists and patent proprietary medicine vendors in Kaduna and Lagos, Nigeria
title The role of job aids in supporting task sharing family planning services to community pharmacists and patent proprietary medicine vendors in Kaduna and Lagos, Nigeria
title_full The role of job aids in supporting task sharing family planning services to community pharmacists and patent proprietary medicine vendors in Kaduna and Lagos, Nigeria
title_fullStr The role of job aids in supporting task sharing family planning services to community pharmacists and patent proprietary medicine vendors in Kaduna and Lagos, Nigeria
title_full_unstemmed The role of job aids in supporting task sharing family planning services to community pharmacists and patent proprietary medicine vendors in Kaduna and Lagos, Nigeria
title_short The role of job aids in supporting task sharing family planning services to community pharmacists and patent proprietary medicine vendors in Kaduna and Lagos, Nigeria
title_sort role of job aids in supporting task sharing family planning services to community pharmacists and patent proprietary medicine vendors in kaduna and lagos, nigeria
topic Research
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9340708/
https://www.ncbi.nlm.nih.gov/pubmed/35915491
http://dx.doi.org/10.1186/s12913-022-08360-0
work_keys_str_mv AT baruwasikiru theroleofjobaidsinsupportingtasksharingfamilyplanningservicestocommunitypharmacistsandpatentproprietarymedicinevendorsinkadunaandlagosnigeria
AT tobeyelizabeth theroleofjobaidsinsupportingtasksharingfamilyplanningservicestocommunitypharmacistsandpatentproprietarymedicinevendorsinkadunaandlagosnigeria
AT okaforemeka theroleofjobaidsinsupportingtasksharingfamilyplanningservicestocommunitypharmacistsandpatentproprietarymedicinevendorsinkadunaandlagosnigeria
AT afolabikayode theroleofjobaidsinsupportingtasksharingfamilyplanningservicestocommunitypharmacistsandpatentproprietarymedicinevendorsinkadunaandlagosnigeria
AT akomolafetoyino theroleofjobaidsinsupportingtasksharingfamilyplanningservicestocommunitypharmacistsandpatentproprietarymedicinevendorsinkadunaandlagosnigeria
AT ubuaneinnocent theroleofjobaidsinsupportingtasksharingfamilyplanningservicestocommunitypharmacistsandpatentproprietarymedicinevendorsinkadunaandlagosnigeria
AT anyantijennifer theroleofjobaidsinsupportingtasksharingfamilyplanningservicestocommunitypharmacistsandpatentproprietarymedicinevendorsinkadunaandlagosnigeria
AT jainaparna theroleofjobaidsinsupportingtasksharingfamilyplanningservicestocommunitypharmacistsandpatentproprietarymedicinevendorsinkadunaandlagosnigeria
AT baruwasikiru roleofjobaidsinsupportingtasksharingfamilyplanningservicestocommunitypharmacistsandpatentproprietarymedicinevendorsinkadunaandlagosnigeria
AT tobeyelizabeth roleofjobaidsinsupportingtasksharingfamilyplanningservicestocommunitypharmacistsandpatentproprietarymedicinevendorsinkadunaandlagosnigeria
AT okaforemeka roleofjobaidsinsupportingtasksharingfamilyplanningservicestocommunitypharmacistsandpatentproprietarymedicinevendorsinkadunaandlagosnigeria
AT afolabikayode roleofjobaidsinsupportingtasksharingfamilyplanningservicestocommunitypharmacistsandpatentproprietarymedicinevendorsinkadunaandlagosnigeria
AT akomolafetoyino roleofjobaidsinsupportingtasksharingfamilyplanningservicestocommunitypharmacistsandpatentproprietarymedicinevendorsinkadunaandlagosnigeria
AT ubuaneinnocent roleofjobaidsinsupportingtasksharingfamilyplanningservicestocommunitypharmacistsandpatentproprietarymedicinevendorsinkadunaandlagosnigeria
AT anyantijennifer roleofjobaidsinsupportingtasksharingfamilyplanningservicestocommunitypharmacistsandpatentproprietarymedicinevendorsinkadunaandlagosnigeria
AT jainaparna roleofjobaidsinsupportingtasksharingfamilyplanningservicestocommunitypharmacistsandpatentproprietarymedicinevendorsinkadunaandlagosnigeria