Cargando…
Efficacy of genotype-matched Newcastle disease virus vaccine formulated in carboxymethyl sago starch acid hydrogel in chickens vaccinated via different routes
BACKGROUND: The commercially available Newcastle disease (ND) vaccines were developed based on Newcastle disease virus (NDV) isolates genetically divergent from field strains that can only prevent clinical disease, not shedding of virulent heterologous virus, highlighting the need to develop genotyp...
Autores principales: | , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
The Korean Society of Veterinary Science
2022
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9346527/ https://www.ncbi.nlm.nih.gov/pubmed/35920119 http://dx.doi.org/10.4142/jvs.21242 |
_version_ | 1784761669160796160 |
---|---|
author | Mahamud, Siti Nor Azizah Bello, Muhammad Bashir Ideris, Aini Omar, Abdul Rahman |
author_facet | Mahamud, Siti Nor Azizah Bello, Muhammad Bashir Ideris, Aini Omar, Abdul Rahman |
author_sort | Mahamud, Siti Nor Azizah |
collection | PubMed |
description | BACKGROUND: The commercially available Newcastle disease (ND) vaccines were developed based on Newcastle disease virus (NDV) isolates genetically divergent from field strains that can only prevent clinical disease, not shedding of virulent heterologous virus, highlighting the need to develop genotype-matched vaccines OBJECTIVES: This study examined the efficacy of the NDV genotype-matched vaccine, mIBS025 strain formulated in standard vaccine stabilizer, and in carboxymethyl sago starch-acid hydrogel (CMSS-AH) following vaccination via an eye drop (ED) and drinking water (DW). METHODS: A challenge virus was prepared from a recent NDV isolated from ND vaccinated flock. Groups of specific-pathogen-free chickens were vaccinated with mIBS025 vaccine strain prepared in a standard vaccine stabilizer and CMSS-AH via ED and DW and then challenged with the UPM/NDV/IBS362/2016 strain. RESULTS: Chickens vaccinated with CMSS-AH mIBS025 ED (group 2) developed the earliest and highest Hemagglutination Inhibition (HI) NDV antibody titer (8log(2)) followed by standard mIBS025 ED (group 3) (7log(2)) both conferred complete protection and drastically reduced virus shedding. By contrast, chickens vaccinated with standard mIBS025 DW (group 5) and CMSS-AH mIBS025 DW (group 4) developed low HI NDV antibody titers of 4log(2) and 3log(2), respectively, which correspondingly conferred only 50% and 60% protection and continuously shed the virulent virus via the oropharyngeal and cloacal routes until the end of the study at 14 dpc. CONCLUSIONS: The efficacy of mIBS025 vaccines prepared in a standard vaccine stabilizer or CMSS-AH was affected by the vaccination routes. The groups vaccinated via ED had better protective immunity than those vaccinated via DW. |
format | Online Article Text |
id | pubmed-9346527 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2022 |
publisher | The Korean Society of Veterinary Science |
record_format | MEDLINE/PubMed |
spelling | pubmed-93465272022-08-11 Efficacy of genotype-matched Newcastle disease virus vaccine formulated in carboxymethyl sago starch acid hydrogel in chickens vaccinated via different routes Mahamud, Siti Nor Azizah Bello, Muhammad Bashir Ideris, Aini Omar, Abdul Rahman J Vet Sci Original Article BACKGROUND: The commercially available Newcastle disease (ND) vaccines were developed based on Newcastle disease virus (NDV) isolates genetically divergent from field strains that can only prevent clinical disease, not shedding of virulent heterologous virus, highlighting the need to develop genotype-matched vaccines OBJECTIVES: This study examined the efficacy of the NDV genotype-matched vaccine, mIBS025 strain formulated in standard vaccine stabilizer, and in carboxymethyl sago starch-acid hydrogel (CMSS-AH) following vaccination via an eye drop (ED) and drinking water (DW). METHODS: A challenge virus was prepared from a recent NDV isolated from ND vaccinated flock. Groups of specific-pathogen-free chickens were vaccinated with mIBS025 vaccine strain prepared in a standard vaccine stabilizer and CMSS-AH via ED and DW and then challenged with the UPM/NDV/IBS362/2016 strain. RESULTS: Chickens vaccinated with CMSS-AH mIBS025 ED (group 2) developed the earliest and highest Hemagglutination Inhibition (HI) NDV antibody titer (8log(2)) followed by standard mIBS025 ED (group 3) (7log(2)) both conferred complete protection and drastically reduced virus shedding. By contrast, chickens vaccinated with standard mIBS025 DW (group 5) and CMSS-AH mIBS025 DW (group 4) developed low HI NDV antibody titers of 4log(2) and 3log(2), respectively, which correspondingly conferred only 50% and 60% protection and continuously shed the virulent virus via the oropharyngeal and cloacal routes until the end of the study at 14 dpc. CONCLUSIONS: The efficacy of mIBS025 vaccines prepared in a standard vaccine stabilizer or CMSS-AH was affected by the vaccination routes. The groups vaccinated via ED had better protective immunity than those vaccinated via DW. The Korean Society of Veterinary Science 2022-01-13 /pmc/articles/PMC9346527/ /pubmed/35920119 http://dx.doi.org/10.4142/jvs.21242 Text en © 2022 The Korean Society of Veterinary Science https://creativecommons.org/licenses/by-nc/4.0/This is an Open Access article distributed under the terms of the Creative Commons Attribution Non-Commercial License (https://creativecommons.org/licenses/by-nc/4.0 (https://creativecommons.org/licenses/by-nc/4.0/) ) which permits unrestricted non-commercial use, distribution, and reproduction in any medium, provided the original work is properly cited. |
spellingShingle | Original Article Mahamud, Siti Nor Azizah Bello, Muhammad Bashir Ideris, Aini Omar, Abdul Rahman Efficacy of genotype-matched Newcastle disease virus vaccine formulated in carboxymethyl sago starch acid hydrogel in chickens vaccinated via different routes |
title | Efficacy of genotype-matched Newcastle disease virus vaccine formulated in carboxymethyl sago starch acid hydrogel in chickens vaccinated via different routes |
title_full | Efficacy of genotype-matched Newcastle disease virus vaccine formulated in carboxymethyl sago starch acid hydrogel in chickens vaccinated via different routes |
title_fullStr | Efficacy of genotype-matched Newcastle disease virus vaccine formulated in carboxymethyl sago starch acid hydrogel in chickens vaccinated via different routes |
title_full_unstemmed | Efficacy of genotype-matched Newcastle disease virus vaccine formulated in carboxymethyl sago starch acid hydrogel in chickens vaccinated via different routes |
title_short | Efficacy of genotype-matched Newcastle disease virus vaccine formulated in carboxymethyl sago starch acid hydrogel in chickens vaccinated via different routes |
title_sort | efficacy of genotype-matched newcastle disease virus vaccine formulated in carboxymethyl sago starch acid hydrogel in chickens vaccinated via different routes |
topic | Original Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9346527/ https://www.ncbi.nlm.nih.gov/pubmed/35920119 http://dx.doi.org/10.4142/jvs.21242 |
work_keys_str_mv | AT mahamudsitinorazizah efficacyofgenotypematchednewcastlediseasevirusvaccineformulatedincarboxymethylsagostarchacidhydrogelinchickensvaccinatedviadifferentroutes AT bellomuhammadbashir efficacyofgenotypematchednewcastlediseasevirusvaccineformulatedincarboxymethylsagostarchacidhydrogelinchickensvaccinatedviadifferentroutes AT iderisaini efficacyofgenotypematchednewcastlediseasevirusvaccineformulatedincarboxymethylsagostarchacidhydrogelinchickensvaccinatedviadifferentroutes AT omarabdulrahman efficacyofgenotypematchednewcastlediseasevirusvaccineformulatedincarboxymethylsagostarchacidhydrogelinchickensvaccinatedviadifferentroutes |