Cargando…

Human Recombinant Alkaline Phosphatase (Ilofotase Alfa) Protects Against Kidney Ischemia-Reperfusion Injury in Mice and Rats Through Adenosine Receptors

Adenosine triphosphate (ATP) released from injured or dying cells is a potent pro-inflammatory “danger” signal. Alkaline phosphatase (AP), an endogenous enzyme that de-phosphorylates extracellular ATP, likely plays an anti-inflammatory role in immune responses. We hypothesized that ilofotase alfa, a...

Descripción completa

Detalles Bibliográficos
Autores principales: Rosin, Diane L., Hall, J. Perry, Zheng, Shuqiu, Huang, Liping, Campos-Bilderback, Silvia, Sandoval, Ruben, Bree, Andrea, Beaumont, Kevin, Miller, Emily, Larsen, Jennifer, Hariri, Ghazal, Kaila, Neelu, Encarnacion, Iain M., Gale, Jeremy D., van Elsas, Andrea, Molitoris, Bruce A., Okusa, Mark D.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Frontiers Media S.A. 2022
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9366018/
https://www.ncbi.nlm.nih.gov/pubmed/35966871
http://dx.doi.org/10.3389/fmed.2022.931293
_version_ 1784765463868211200
author Rosin, Diane L.
Hall, J. Perry
Zheng, Shuqiu
Huang, Liping
Campos-Bilderback, Silvia
Sandoval, Ruben
Bree, Andrea
Beaumont, Kevin
Miller, Emily
Larsen, Jennifer
Hariri, Ghazal
Kaila, Neelu
Encarnacion, Iain M.
Gale, Jeremy D.
van Elsas, Andrea
Molitoris, Bruce A.
Okusa, Mark D.
author_facet Rosin, Diane L.
Hall, J. Perry
Zheng, Shuqiu
Huang, Liping
Campos-Bilderback, Silvia
Sandoval, Ruben
Bree, Andrea
Beaumont, Kevin
Miller, Emily
Larsen, Jennifer
Hariri, Ghazal
Kaila, Neelu
Encarnacion, Iain M.
Gale, Jeremy D.
van Elsas, Andrea
Molitoris, Bruce A.
Okusa, Mark D.
author_sort Rosin, Diane L.
collection PubMed
description Adenosine triphosphate (ATP) released from injured or dying cells is a potent pro-inflammatory “danger” signal. Alkaline phosphatase (AP), an endogenous enzyme that de-phosphorylates extracellular ATP, likely plays an anti-inflammatory role in immune responses. We hypothesized that ilofotase alfa, a human recombinant AP, protects kidneys from ischemia-reperfusion injury (IRI), a model of acute kidney injury (AKI), by metabolizing extracellular ATP to adenosine, which is known to activate adenosine receptors. Ilofotase alfa (iv) with or without ZM241,385 (sc), a selective adenosine A(2A) receptor (A(2A)R) antagonist, was administered 1 h before bilateral IRI in WT, A(2A)R KO (Adora2a(–/–)) or CD73(–/–) mice. In additional studies recombinant alkaline phosphatase was given after IRI. In an AKI-on-chronic kidney disease (CKD) ischemic rat model, ilofotase alfa was given after the three instances of IRI and rats were followed for 56 days. Ilofotase alfa in a dose dependent manner decreased IRI in WT mice, an effect prevented by ZM241,385 and partially prevented in Adora2a(–/–) mice. Enzymatically inactive ilofotase alfa was not protective. Ilofotase alfa rescued CD73(–/–) mice, which lack a 5′-ectonucleotidase that dephosphorylates AMP to adenosine; ZM241,385 inhibited that protection. In both rats and mice ilofotase alfa ameliorated IRI when administered after injury, thus providing relevance for therapeutic dosing of ilofotase alfa following established AKI. In an AKI-on-CKD ischemic rat model, ilofotase alfa given after the third instance of IRI reduced injury. These results suggest that ilofotase alfa promotes production of adenosine from liberated ATP in injured kidney tissue, thereby amplifying endogenous mechanisms that can reverse tissue injury, in part through A(2A)R-and non-A(2A)R-dependent signaling pathways.
format Online
Article
Text
id pubmed-9366018
institution National Center for Biotechnology Information
language English
publishDate 2022
publisher Frontiers Media S.A.
record_format MEDLINE/PubMed
spelling pubmed-93660182022-08-12 Human Recombinant Alkaline Phosphatase (Ilofotase Alfa) Protects Against Kidney Ischemia-Reperfusion Injury in Mice and Rats Through Adenosine Receptors Rosin, Diane L. Hall, J. Perry Zheng, Shuqiu Huang, Liping Campos-Bilderback, Silvia Sandoval, Ruben Bree, Andrea Beaumont, Kevin Miller, Emily Larsen, Jennifer Hariri, Ghazal Kaila, Neelu Encarnacion, Iain M. Gale, Jeremy D. van Elsas, Andrea Molitoris, Bruce A. Okusa, Mark D. Front Med (Lausanne) Medicine Adenosine triphosphate (ATP) released from injured or dying cells is a potent pro-inflammatory “danger” signal. Alkaline phosphatase (AP), an endogenous enzyme that de-phosphorylates extracellular ATP, likely plays an anti-inflammatory role in immune responses. We hypothesized that ilofotase alfa, a human recombinant AP, protects kidneys from ischemia-reperfusion injury (IRI), a model of acute kidney injury (AKI), by metabolizing extracellular ATP to adenosine, which is known to activate adenosine receptors. Ilofotase alfa (iv) with or without ZM241,385 (sc), a selective adenosine A(2A) receptor (A(2A)R) antagonist, was administered 1 h before bilateral IRI in WT, A(2A)R KO (Adora2a(–/–)) or CD73(–/–) mice. In additional studies recombinant alkaline phosphatase was given after IRI. In an AKI-on-chronic kidney disease (CKD) ischemic rat model, ilofotase alfa was given after the three instances of IRI and rats were followed for 56 days. Ilofotase alfa in a dose dependent manner decreased IRI in WT mice, an effect prevented by ZM241,385 and partially prevented in Adora2a(–/–) mice. Enzymatically inactive ilofotase alfa was not protective. Ilofotase alfa rescued CD73(–/–) mice, which lack a 5′-ectonucleotidase that dephosphorylates AMP to adenosine; ZM241,385 inhibited that protection. In both rats and mice ilofotase alfa ameliorated IRI when administered after injury, thus providing relevance for therapeutic dosing of ilofotase alfa following established AKI. In an AKI-on-CKD ischemic rat model, ilofotase alfa given after the third instance of IRI reduced injury. These results suggest that ilofotase alfa promotes production of adenosine from liberated ATP in injured kidney tissue, thereby amplifying endogenous mechanisms that can reverse tissue injury, in part through A(2A)R-and non-A(2A)R-dependent signaling pathways. Frontiers Media S.A. 2022-07-28 /pmc/articles/PMC9366018/ /pubmed/35966871 http://dx.doi.org/10.3389/fmed.2022.931293 Text en Copyright © 2022 Rosin, Hall, Zheng, Huang, Campos-Bilderback, Sandoval, Bree, Beaumont, Miller, Larsen, Hariri, Kaila, Encarnacion, Gale, van Elsas, Molitoris and Okusa. https://creativecommons.org/licenses/by/4.0/This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) and the copyright owner(s) are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms.
spellingShingle Medicine
Rosin, Diane L.
Hall, J. Perry
Zheng, Shuqiu
Huang, Liping
Campos-Bilderback, Silvia
Sandoval, Ruben
Bree, Andrea
Beaumont, Kevin
Miller, Emily
Larsen, Jennifer
Hariri, Ghazal
Kaila, Neelu
Encarnacion, Iain M.
Gale, Jeremy D.
van Elsas, Andrea
Molitoris, Bruce A.
Okusa, Mark D.
Human Recombinant Alkaline Phosphatase (Ilofotase Alfa) Protects Against Kidney Ischemia-Reperfusion Injury in Mice and Rats Through Adenosine Receptors
title Human Recombinant Alkaline Phosphatase (Ilofotase Alfa) Protects Against Kidney Ischemia-Reperfusion Injury in Mice and Rats Through Adenosine Receptors
title_full Human Recombinant Alkaline Phosphatase (Ilofotase Alfa) Protects Against Kidney Ischemia-Reperfusion Injury in Mice and Rats Through Adenosine Receptors
title_fullStr Human Recombinant Alkaline Phosphatase (Ilofotase Alfa) Protects Against Kidney Ischemia-Reperfusion Injury in Mice and Rats Through Adenosine Receptors
title_full_unstemmed Human Recombinant Alkaline Phosphatase (Ilofotase Alfa) Protects Against Kidney Ischemia-Reperfusion Injury in Mice and Rats Through Adenosine Receptors
title_short Human Recombinant Alkaline Phosphatase (Ilofotase Alfa) Protects Against Kidney Ischemia-Reperfusion Injury in Mice and Rats Through Adenosine Receptors
title_sort human recombinant alkaline phosphatase (ilofotase alfa) protects against kidney ischemia-reperfusion injury in mice and rats through adenosine receptors
topic Medicine
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9366018/
https://www.ncbi.nlm.nih.gov/pubmed/35966871
http://dx.doi.org/10.3389/fmed.2022.931293
work_keys_str_mv AT rosindianel humanrecombinantalkalinephosphataseilofotasealfaprotectsagainstkidneyischemiareperfusioninjuryinmiceandratsthroughadenosinereceptors
AT halljperry humanrecombinantalkalinephosphataseilofotasealfaprotectsagainstkidneyischemiareperfusioninjuryinmiceandratsthroughadenosinereceptors
AT zhengshuqiu humanrecombinantalkalinephosphataseilofotasealfaprotectsagainstkidneyischemiareperfusioninjuryinmiceandratsthroughadenosinereceptors
AT huangliping humanrecombinantalkalinephosphataseilofotasealfaprotectsagainstkidneyischemiareperfusioninjuryinmiceandratsthroughadenosinereceptors
AT camposbilderbacksilvia humanrecombinantalkalinephosphataseilofotasealfaprotectsagainstkidneyischemiareperfusioninjuryinmiceandratsthroughadenosinereceptors
AT sandovalruben humanrecombinantalkalinephosphataseilofotasealfaprotectsagainstkidneyischemiareperfusioninjuryinmiceandratsthroughadenosinereceptors
AT breeandrea humanrecombinantalkalinephosphataseilofotasealfaprotectsagainstkidneyischemiareperfusioninjuryinmiceandratsthroughadenosinereceptors
AT beaumontkevin humanrecombinantalkalinephosphataseilofotasealfaprotectsagainstkidneyischemiareperfusioninjuryinmiceandratsthroughadenosinereceptors
AT milleremily humanrecombinantalkalinephosphataseilofotasealfaprotectsagainstkidneyischemiareperfusioninjuryinmiceandratsthroughadenosinereceptors
AT larsenjennifer humanrecombinantalkalinephosphataseilofotasealfaprotectsagainstkidneyischemiareperfusioninjuryinmiceandratsthroughadenosinereceptors
AT haririghazal humanrecombinantalkalinephosphataseilofotasealfaprotectsagainstkidneyischemiareperfusioninjuryinmiceandratsthroughadenosinereceptors
AT kailaneelu humanrecombinantalkalinephosphataseilofotasealfaprotectsagainstkidneyischemiareperfusioninjuryinmiceandratsthroughadenosinereceptors
AT encarnacioniainm humanrecombinantalkalinephosphataseilofotasealfaprotectsagainstkidneyischemiareperfusioninjuryinmiceandratsthroughadenosinereceptors
AT galejeremyd humanrecombinantalkalinephosphataseilofotasealfaprotectsagainstkidneyischemiareperfusioninjuryinmiceandratsthroughadenosinereceptors
AT vanelsasandrea humanrecombinantalkalinephosphataseilofotasealfaprotectsagainstkidneyischemiareperfusioninjuryinmiceandratsthroughadenosinereceptors
AT molitorisbrucea humanrecombinantalkalinephosphataseilofotasealfaprotectsagainstkidneyischemiareperfusioninjuryinmiceandratsthroughadenosinereceptors
AT okusamarkd humanrecombinantalkalinephosphataseilofotasealfaprotectsagainstkidneyischemiareperfusioninjuryinmiceandratsthroughadenosinereceptors