Cargando…

The m(6)A methyltransferase WTAP plays a key role in the development of diffuse large B-cell lymphoma via regulating the m(6)A modification of catenin beta 1

BACKGROUND: Diffuse large B-cell lymphoma (DLBCL) is the most frequently occurring subtype of lymphoma. Unfortunately, the fundamental processes underlying the pathogenesis of DLBCL remain little understood. N(6)-methyladenosine (m(6)A) methylation has been shown to be the most common internal alter...

Descripción completa

Detalles Bibliográficos
Autores principales: Guo, Shuangshuang, Zhao, Chunling, Fang, Liang, Xu, Wenzhong, Dalia, Samir, Glass, Jon, Shikama, Naoto, Zhang, Zhiye
Formato: Online Artículo Texto
Lenguaje:English
Publicado: AME Publishing Company 2022
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9372676/
https://www.ncbi.nlm.nih.gov/pubmed/35965785
http://dx.doi.org/10.21037/atm-22-3027
_version_ 1784767439529050112
author Guo, Shuangshuang
Zhao, Chunling
Fang, Liang
Xu, Wenzhong
Dalia, Samir
Glass, Jon
Shikama, Naoto
Zhang, Zhiye
author_facet Guo, Shuangshuang
Zhao, Chunling
Fang, Liang
Xu, Wenzhong
Dalia, Samir
Glass, Jon
Shikama, Naoto
Zhang, Zhiye
author_sort Guo, Shuangshuang
collection PubMed
description BACKGROUND: Diffuse large B-cell lymphoma (DLBCL) is the most frequently occurring subtype of lymphoma. Unfortunately, the fundamental processes underlying the pathogenesis of DLBCL remain little understood. N(6)-methyladenosine (m(6)A) methylation has been shown to be the most common internal alteration of mRNAs found in eukaryotes, and it is thought to play a key role in cancer pathogenesis. However, the precise relationship between m(6)A mRNA methylation and DLBCL pathogenesis remains to be fully elucidated. METHODS: The mRNA and protein expression of Wilms tumor 1-associating protein (WTAP) were determined using quantitative real-time polymerase chain reaction (qRT-PCR) and Western blot analysis in lymphoma cells lines. The effects of WTAP expression on human lymphoma cells lines were assessed using cell proliferation assays, colony formation assays, and CCK8 assays. The Gene Expression Profiling Interactive Analysis (GEPIA) database was used to screen candidate gene targets of WTAP. Finally, the regulatory mechanisms of WTAP in DLBCL were investigated using methylated RNA immunoprecipitation (MeRIP) assays. RESULTS: This study investigated the precise function of WTAP in DLBCL formation. The results demonstrated that the levels of m(6)A RNA methylation and WTAP expression were both elevated in DLBCL cell lines and tissues. Downregulation of WTAP expression in DLBCL cells caused a reduction in cell growth in a functional sense. WTAP knockdown reduced catenin beta 1 (CTNNB1) m(6)A methylation and CTNNB1 total mRNA levels. Furthermore, CTNNB1 overexpression eliminated the WTAP-induced reduction of cell growth in DLBCL cells. CONCLUSIONS: In conclusion, these findings demonstrated that WTAP promotes DLBCL development via modulation of m(6)A methylation in CTNNB1.
format Online
Article
Text
id pubmed-9372676
institution National Center for Biotechnology Information
language English
publishDate 2022
publisher AME Publishing Company
record_format MEDLINE/PubMed
spelling pubmed-93726762022-08-13 The m(6)A methyltransferase WTAP plays a key role in the development of diffuse large B-cell lymphoma via regulating the m(6)A modification of catenin beta 1 Guo, Shuangshuang Zhao, Chunling Fang, Liang Xu, Wenzhong Dalia, Samir Glass, Jon Shikama, Naoto Zhang, Zhiye Ann Transl Med Original Article BACKGROUND: Diffuse large B-cell lymphoma (DLBCL) is the most frequently occurring subtype of lymphoma. Unfortunately, the fundamental processes underlying the pathogenesis of DLBCL remain little understood. N(6)-methyladenosine (m(6)A) methylation has been shown to be the most common internal alteration of mRNAs found in eukaryotes, and it is thought to play a key role in cancer pathogenesis. However, the precise relationship between m(6)A mRNA methylation and DLBCL pathogenesis remains to be fully elucidated. METHODS: The mRNA and protein expression of Wilms tumor 1-associating protein (WTAP) were determined using quantitative real-time polymerase chain reaction (qRT-PCR) and Western blot analysis in lymphoma cells lines. The effects of WTAP expression on human lymphoma cells lines were assessed using cell proliferation assays, colony formation assays, and CCK8 assays. The Gene Expression Profiling Interactive Analysis (GEPIA) database was used to screen candidate gene targets of WTAP. Finally, the regulatory mechanisms of WTAP in DLBCL were investigated using methylated RNA immunoprecipitation (MeRIP) assays. RESULTS: This study investigated the precise function of WTAP in DLBCL formation. The results demonstrated that the levels of m(6)A RNA methylation and WTAP expression were both elevated in DLBCL cell lines and tissues. Downregulation of WTAP expression in DLBCL cells caused a reduction in cell growth in a functional sense. WTAP knockdown reduced catenin beta 1 (CTNNB1) m(6)A methylation and CTNNB1 total mRNA levels. Furthermore, CTNNB1 overexpression eliminated the WTAP-induced reduction of cell growth in DLBCL cells. CONCLUSIONS: In conclusion, these findings demonstrated that WTAP promotes DLBCL development via modulation of m(6)A methylation in CTNNB1. AME Publishing Company 2022-07 /pmc/articles/PMC9372676/ /pubmed/35965785 http://dx.doi.org/10.21037/atm-22-3027 Text en 2022 Annals of Translational Medicine. All rights reserved. https://creativecommons.org/licenses/by-nc-nd/4.0/Open Access Statement: This is an Open Access article distributed in accordance with the Creative Commons Attribution-NonCommercial-NoDerivs 4.0 International License (CC BY-NC-ND 4.0), which permits the non-commercial replication and distribution of the article with the strict proviso that no changes or edits are made and the original work is properly cited (including links to both the formal publication through the relevant DOI and the license). See: https://creativecommons.org/licenses/by-nc-nd/4.0 (https://creativecommons.org/licenses/by-nc-nd/4.0/) .
spellingShingle Original Article
Guo, Shuangshuang
Zhao, Chunling
Fang, Liang
Xu, Wenzhong
Dalia, Samir
Glass, Jon
Shikama, Naoto
Zhang, Zhiye
The m(6)A methyltransferase WTAP plays a key role in the development of diffuse large B-cell lymphoma via regulating the m(6)A modification of catenin beta 1
title The m(6)A methyltransferase WTAP plays a key role in the development of diffuse large B-cell lymphoma via regulating the m(6)A modification of catenin beta 1
title_full The m(6)A methyltransferase WTAP plays a key role in the development of diffuse large B-cell lymphoma via regulating the m(6)A modification of catenin beta 1
title_fullStr The m(6)A methyltransferase WTAP plays a key role in the development of diffuse large B-cell lymphoma via regulating the m(6)A modification of catenin beta 1
title_full_unstemmed The m(6)A methyltransferase WTAP plays a key role in the development of diffuse large B-cell lymphoma via regulating the m(6)A modification of catenin beta 1
title_short The m(6)A methyltransferase WTAP plays a key role in the development of diffuse large B-cell lymphoma via regulating the m(6)A modification of catenin beta 1
title_sort m(6)a methyltransferase wtap plays a key role in the development of diffuse large b-cell lymphoma via regulating the m(6)a modification of catenin beta 1
topic Original Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9372676/
https://www.ncbi.nlm.nih.gov/pubmed/35965785
http://dx.doi.org/10.21037/atm-22-3027
work_keys_str_mv AT guoshuangshuang them6amethyltransferasewtapplaysakeyroleinthedevelopmentofdiffuselargebcelllymphomaviaregulatingthem6amodificationofcateninbeta1
AT zhaochunling them6amethyltransferasewtapplaysakeyroleinthedevelopmentofdiffuselargebcelllymphomaviaregulatingthem6amodificationofcateninbeta1
AT fangliang them6amethyltransferasewtapplaysakeyroleinthedevelopmentofdiffuselargebcelllymphomaviaregulatingthem6amodificationofcateninbeta1
AT xuwenzhong them6amethyltransferasewtapplaysakeyroleinthedevelopmentofdiffuselargebcelllymphomaviaregulatingthem6amodificationofcateninbeta1
AT daliasamir them6amethyltransferasewtapplaysakeyroleinthedevelopmentofdiffuselargebcelllymphomaviaregulatingthem6amodificationofcateninbeta1
AT glassjon them6amethyltransferasewtapplaysakeyroleinthedevelopmentofdiffuselargebcelllymphomaviaregulatingthem6amodificationofcateninbeta1
AT shikamanaoto them6amethyltransferasewtapplaysakeyroleinthedevelopmentofdiffuselargebcelllymphomaviaregulatingthem6amodificationofcateninbeta1
AT zhangzhiye them6amethyltransferasewtapplaysakeyroleinthedevelopmentofdiffuselargebcelllymphomaviaregulatingthem6amodificationofcateninbeta1
AT guoshuangshuang m6amethyltransferasewtapplaysakeyroleinthedevelopmentofdiffuselargebcelllymphomaviaregulatingthem6amodificationofcateninbeta1
AT zhaochunling m6amethyltransferasewtapplaysakeyroleinthedevelopmentofdiffuselargebcelllymphomaviaregulatingthem6amodificationofcateninbeta1
AT fangliang m6amethyltransferasewtapplaysakeyroleinthedevelopmentofdiffuselargebcelllymphomaviaregulatingthem6amodificationofcateninbeta1
AT xuwenzhong m6amethyltransferasewtapplaysakeyroleinthedevelopmentofdiffuselargebcelllymphomaviaregulatingthem6amodificationofcateninbeta1
AT daliasamir m6amethyltransferasewtapplaysakeyroleinthedevelopmentofdiffuselargebcelllymphomaviaregulatingthem6amodificationofcateninbeta1
AT glassjon m6amethyltransferasewtapplaysakeyroleinthedevelopmentofdiffuselargebcelllymphomaviaregulatingthem6amodificationofcateninbeta1
AT shikamanaoto m6amethyltransferasewtapplaysakeyroleinthedevelopmentofdiffuselargebcelllymphomaviaregulatingthem6amodificationofcateninbeta1
AT zhangzhiye m6amethyltransferasewtapplaysakeyroleinthedevelopmentofdiffuselargebcelllymphomaviaregulatingthem6amodificationofcateninbeta1