Cargando…

Loss of MEN1 leads to renal fibrosis and decreases HGF‐Adamts5 pathway activity via an epigenetic mechanism

BACKGROUND: Renal fibrosis is a serious condition that results in the development of chronic kidney diseases. The MEN1 gene is an epigenetic regulator that encodes the menin protein and its role in kidney tissue remains unclear. METHODS: Kidney histology was examined on paraffin sections stained wit...

Descripción completa

Detalles Bibliográficos
Autores principales: Jin, Bangming, Zhu, Jiamei, Zhou, Yuxia, Liang, Li, Yang, Yunqiao, Xu, Lifen, Zhang, Tuo, Li, Po, Pan, Ting, Guo, Bing, Chen, Tengxiang, Li, Haiyang
Formato: Online Artículo Texto
Lenguaje:English
Publicado: John Wiley and Sons Inc. 2022
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9377152/
https://www.ncbi.nlm.nih.gov/pubmed/35968938
http://dx.doi.org/10.1002/ctm2.982
_version_ 1784768282637631488
author Jin, Bangming
Zhu, Jiamei
Zhou, Yuxia
Liang, Li
Yang, Yunqiao
Xu, Lifen
Zhang, Tuo
Li, Po
Pan, Ting
Guo, Bing
Chen, Tengxiang
Li, Haiyang
author_facet Jin, Bangming
Zhu, Jiamei
Zhou, Yuxia
Liang, Li
Yang, Yunqiao
Xu, Lifen
Zhang, Tuo
Li, Po
Pan, Ting
Guo, Bing
Chen, Tengxiang
Li, Haiyang
author_sort Jin, Bangming
collection PubMed
description BACKGROUND: Renal fibrosis is a serious condition that results in the development of chronic kidney diseases. The MEN1 gene is an epigenetic regulator that encodes the menin protein and its role in kidney tissue remains unclear. METHODS: Kidney histology was examined on paraffin sections stained with hematoxylin‐eosin staining. Masson’s trichrome staining and Sirius red staining were used to analyze renal fibrosis. Gene and protein expression were determined by quantitative real‐time PCR (qPCR) and Western blot, respectively. Immunohistochemistry staining in the kidney tissues from mice or patients was used to evaluate protein levels. Flow cytometry was used to analyze the cell cycle distributions and apoptosis. RNA‐sequencing was performed for differential expression genes in the kidney tissues of the Men1f/f and Men1∆/∆ mice. Chromatin immunoprecipitation sequencing (ChIP‐seq) was carried out for identification of menin‐ and H3K4me3‐enriched regions within the whole genome in the mouse kidney tissue. ChIP‐qPCR assays were performed for occupancy of menin and H3K4me3 at the gene promoter regions. Luciferase reporter assay was used to detect the promoter activity. The exacerbated unilateral ureteral obstruction (UUO) models in the Men1f/f and Men1∆/∆ mice were used to assess the pharmacological effects of rh‐HGF on renal fibrosis. RESULTS: The expression of MEN1 is reduce in kidney tissues of fibrotic mouse and human diabetic patients and treatment with fibrotic factor results in the downregulation of MEN1 expression in renal tubular epithelial cells (RTECs). Disruption of MEN1 in RTECs leads to high expression of α‐SMA and Collagen 1, whereas MEN1 overexpression restrains epithelial‐to‐mesenchymal transition (EMT) induced by TGF‐β treatment. Conditional knockout of MEN1 resulted in chronic renal fibrosis and UUO‐induced tubulointerstitial fibrosis (TIF), which is associated with an increased induction of EMT, G2/M arrest and JNK signaling. Mechanistically, menin recruits and increases H3K4me3 at the promoter regions of hepatocyte growth factor (HGF) and a disintegrin and metalloproteinase with thrombospondin motifs 5 (Adamts5) genes and enhances their transcriptional activation. In the UUO mice model, exogenous HGF restored the expression of Adamts5 and ameliorated renal fibrosis induced by Men1 deficiency. CONCLUSIONS: These findings demonstrate that MEN1 is an essential antifibrotic factor in renal fibrogenesis and could be a potential target for antifibrotic therapy.
format Online
Article
Text
id pubmed-9377152
institution National Center for Biotechnology Information
language English
publishDate 2022
publisher John Wiley and Sons Inc.
record_format MEDLINE/PubMed
spelling pubmed-93771522022-08-18 Loss of MEN1 leads to renal fibrosis and decreases HGF‐Adamts5 pathway activity via an epigenetic mechanism Jin, Bangming Zhu, Jiamei Zhou, Yuxia Liang, Li Yang, Yunqiao Xu, Lifen Zhang, Tuo Li, Po Pan, Ting Guo, Bing Chen, Tengxiang Li, Haiyang Clin Transl Med Research Articles BACKGROUND: Renal fibrosis is a serious condition that results in the development of chronic kidney diseases. The MEN1 gene is an epigenetic regulator that encodes the menin protein and its role in kidney tissue remains unclear. METHODS: Kidney histology was examined on paraffin sections stained with hematoxylin‐eosin staining. Masson’s trichrome staining and Sirius red staining were used to analyze renal fibrosis. Gene and protein expression were determined by quantitative real‐time PCR (qPCR) and Western blot, respectively. Immunohistochemistry staining in the kidney tissues from mice or patients was used to evaluate protein levels. Flow cytometry was used to analyze the cell cycle distributions and apoptosis. RNA‐sequencing was performed for differential expression genes in the kidney tissues of the Men1f/f and Men1∆/∆ mice. Chromatin immunoprecipitation sequencing (ChIP‐seq) was carried out for identification of menin‐ and H3K4me3‐enriched regions within the whole genome in the mouse kidney tissue. ChIP‐qPCR assays were performed for occupancy of menin and H3K4me3 at the gene promoter regions. Luciferase reporter assay was used to detect the promoter activity. The exacerbated unilateral ureteral obstruction (UUO) models in the Men1f/f and Men1∆/∆ mice were used to assess the pharmacological effects of rh‐HGF on renal fibrosis. RESULTS: The expression of MEN1 is reduce in kidney tissues of fibrotic mouse and human diabetic patients and treatment with fibrotic factor results in the downregulation of MEN1 expression in renal tubular epithelial cells (RTECs). Disruption of MEN1 in RTECs leads to high expression of α‐SMA and Collagen 1, whereas MEN1 overexpression restrains epithelial‐to‐mesenchymal transition (EMT) induced by TGF‐β treatment. Conditional knockout of MEN1 resulted in chronic renal fibrosis and UUO‐induced tubulointerstitial fibrosis (TIF), which is associated with an increased induction of EMT, G2/M arrest and JNK signaling. Mechanistically, menin recruits and increases H3K4me3 at the promoter regions of hepatocyte growth factor (HGF) and a disintegrin and metalloproteinase with thrombospondin motifs 5 (Adamts5) genes and enhances their transcriptional activation. In the UUO mice model, exogenous HGF restored the expression of Adamts5 and ameliorated renal fibrosis induced by Men1 deficiency. CONCLUSIONS: These findings demonstrate that MEN1 is an essential antifibrotic factor in renal fibrogenesis and could be a potential target for antifibrotic therapy. John Wiley and Sons Inc. 2022-08-15 /pmc/articles/PMC9377152/ /pubmed/35968938 http://dx.doi.org/10.1002/ctm2.982 Text en © 2022 The Authors. Clinical and Translational Medicine published by John Wiley & Sons Australia, Ltd on behalf of Shanghai Institute of Clinical Bioinformatics. https://creativecommons.org/licenses/by/4.0/This is an open access article under the terms of the http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) License, which permits use, distribution and reproduction in any medium, provided the original work is properly cited.
spellingShingle Research Articles
Jin, Bangming
Zhu, Jiamei
Zhou, Yuxia
Liang, Li
Yang, Yunqiao
Xu, Lifen
Zhang, Tuo
Li, Po
Pan, Ting
Guo, Bing
Chen, Tengxiang
Li, Haiyang
Loss of MEN1 leads to renal fibrosis and decreases HGF‐Adamts5 pathway activity via an epigenetic mechanism
title Loss of MEN1 leads to renal fibrosis and decreases HGF‐Adamts5 pathway activity via an epigenetic mechanism
title_full Loss of MEN1 leads to renal fibrosis and decreases HGF‐Adamts5 pathway activity via an epigenetic mechanism
title_fullStr Loss of MEN1 leads to renal fibrosis and decreases HGF‐Adamts5 pathway activity via an epigenetic mechanism
title_full_unstemmed Loss of MEN1 leads to renal fibrosis and decreases HGF‐Adamts5 pathway activity via an epigenetic mechanism
title_short Loss of MEN1 leads to renal fibrosis and decreases HGF‐Adamts5 pathway activity via an epigenetic mechanism
title_sort loss of men1 leads to renal fibrosis and decreases hgf‐adamts5 pathway activity via an epigenetic mechanism
topic Research Articles
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9377152/
https://www.ncbi.nlm.nih.gov/pubmed/35968938
http://dx.doi.org/10.1002/ctm2.982
work_keys_str_mv AT jinbangming lossofmen1leadstorenalfibrosisanddecreaseshgfadamts5pathwayactivityviaanepigeneticmechanism
AT zhujiamei lossofmen1leadstorenalfibrosisanddecreaseshgfadamts5pathwayactivityviaanepigeneticmechanism
AT zhouyuxia lossofmen1leadstorenalfibrosisanddecreaseshgfadamts5pathwayactivityviaanepigeneticmechanism
AT liangli lossofmen1leadstorenalfibrosisanddecreaseshgfadamts5pathwayactivityviaanepigeneticmechanism
AT yangyunqiao lossofmen1leadstorenalfibrosisanddecreaseshgfadamts5pathwayactivityviaanepigeneticmechanism
AT xulifen lossofmen1leadstorenalfibrosisanddecreaseshgfadamts5pathwayactivityviaanepigeneticmechanism
AT zhangtuo lossofmen1leadstorenalfibrosisanddecreaseshgfadamts5pathwayactivityviaanepigeneticmechanism
AT lipo lossofmen1leadstorenalfibrosisanddecreaseshgfadamts5pathwayactivityviaanepigeneticmechanism
AT panting lossofmen1leadstorenalfibrosisanddecreaseshgfadamts5pathwayactivityviaanepigeneticmechanism
AT guobing lossofmen1leadstorenalfibrosisanddecreaseshgfadamts5pathwayactivityviaanepigeneticmechanism
AT chentengxiang lossofmen1leadstorenalfibrosisanddecreaseshgfadamts5pathwayactivityviaanepigeneticmechanism
AT lihaiyang lossofmen1leadstorenalfibrosisanddecreaseshgfadamts5pathwayactivityviaanepigeneticmechanism