Cargando…
Validation of the Simplified Disease Activity Index (SDAI) with a quick quantitative C-reactive protein assay (SDAI-Q) in patients with rheumatoid arthritis: a prospective multicenter cross-sectional study
OBJECTIVES: The Simplified Disease Activity Index (SDAI) is a recommended composite score for assessing the remission status in patients with rheumatoid arthritis (RA). However, determination of C-reactive protein (CRP) levels takes several hours and sometimes days and limits the use of the SDAI in...
Autores principales: | , , , , , , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
SAGE Publications
2022
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9393358/ https://www.ncbi.nlm.nih.gov/pubmed/36003590 http://dx.doi.org/10.1177/1759720X221114107 |
_version_ | 1784771256500879360 |
---|---|
author | Schally, Julia Brandt, Henning Christian Brandt-Jürgens, Jan Burmester, Gerd R. Haibel, Hildrun Käding, Henriette Karberg, Kirsten Lüders, Susanne Muche, Burkhard Protopopov, Mikhail Rios Rodriguez, Valeria Torgutalp, Murat Verba, Maryna Zinke, Silke Poddubnyy, Denis Proft, Fabian |
author_facet | Schally, Julia Brandt, Henning Christian Brandt-Jürgens, Jan Burmester, Gerd R. Haibel, Hildrun Käding, Henriette Karberg, Kirsten Lüders, Susanne Muche, Burkhard Protopopov, Mikhail Rios Rodriguez, Valeria Torgutalp, Murat Verba, Maryna Zinke, Silke Poddubnyy, Denis Proft, Fabian |
author_sort | Schally, Julia |
collection | PubMed |
description | OBJECTIVES: The Simplified Disease Activity Index (SDAI) is a recommended composite score for assessing the remission status in patients with rheumatoid arthritis (RA). However, determination of C-reactive protein (CRP) levels takes several hours and sometimes days and limits the use of the SDAI in the clinical setting. The aim of this study was to validate the SDAI using a quick quantitative C-reactive protein (qCRP) assay (as SDAI-Q) in RA patients. DESIGN: This is a multicenter, prospective, cross-sectional pilot study in RA patients. METHODS: Adult patients (⩾18 years) with a clinical diagnosis of RA were recruited between January 2020 and September 2020 from five rheumatologic centers located in Berlin, Germany. SDAI, SDAI-Q, Clinical Disease Activity Index (CDAI), and DAS28 scores comprising CRP, qCRP, or erythrocyte sedimentation rate (ESR) were calculated. The agreement of disease activity categories was analyzed using cross tabulations and weighted Cohen’s kappa. The agreement of numerical values was analyzed with Bland–Altman plots and intraclass correlation coefficients (ICCs). RESULTS: Overall, 100 RA patients were included in the statistical analysis. The mean value of qCRP (7.89 ± 16.98 mg/l) was slightly higher than that of routine laboratory CRP (6.97 ± 15.02 mg/l). Comparing SDAI and SDAI-Q, all patients were assigned to identical disease activity categories. Agreement of disease activity categories by CDAI and SDAI/SDAI-Q was observed in 93% with a weighted Cohen’s kappa of 0.929 (95% confidence interval (CI) = 0.878; 0.981). CONCLUSION: The SDAI-Q showed an absolute agreement regarding the assignment of disease activity categories in comparison with the conventional SDAI. Therefore, the SDAI-Q may facilitate the application of a treat-to-target concept in clinical trials and clinical routine as a quickly available disease activity score incorporating CRP as an objective parameter. |
format | Online Article Text |
id | pubmed-9393358 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2022 |
publisher | SAGE Publications |
record_format | MEDLINE/PubMed |
spelling | pubmed-93933582022-08-23 Validation of the Simplified Disease Activity Index (SDAI) with a quick quantitative C-reactive protein assay (SDAI-Q) in patients with rheumatoid arthritis: a prospective multicenter cross-sectional study Schally, Julia Brandt, Henning Christian Brandt-Jürgens, Jan Burmester, Gerd R. Haibel, Hildrun Käding, Henriette Karberg, Kirsten Lüders, Susanne Muche, Burkhard Protopopov, Mikhail Rios Rodriguez, Valeria Torgutalp, Murat Verba, Maryna Zinke, Silke Poddubnyy, Denis Proft, Fabian Ther Adv Musculoskelet Dis Original Research OBJECTIVES: The Simplified Disease Activity Index (SDAI) is a recommended composite score for assessing the remission status in patients with rheumatoid arthritis (RA). However, determination of C-reactive protein (CRP) levels takes several hours and sometimes days and limits the use of the SDAI in the clinical setting. The aim of this study was to validate the SDAI using a quick quantitative C-reactive protein (qCRP) assay (as SDAI-Q) in RA patients. DESIGN: This is a multicenter, prospective, cross-sectional pilot study in RA patients. METHODS: Adult patients (⩾18 years) with a clinical diagnosis of RA were recruited between January 2020 and September 2020 from five rheumatologic centers located in Berlin, Germany. SDAI, SDAI-Q, Clinical Disease Activity Index (CDAI), and DAS28 scores comprising CRP, qCRP, or erythrocyte sedimentation rate (ESR) were calculated. The agreement of disease activity categories was analyzed using cross tabulations and weighted Cohen’s kappa. The agreement of numerical values was analyzed with Bland–Altman plots and intraclass correlation coefficients (ICCs). RESULTS: Overall, 100 RA patients were included in the statistical analysis. The mean value of qCRP (7.89 ± 16.98 mg/l) was slightly higher than that of routine laboratory CRP (6.97 ± 15.02 mg/l). Comparing SDAI and SDAI-Q, all patients were assigned to identical disease activity categories. Agreement of disease activity categories by CDAI and SDAI/SDAI-Q was observed in 93% with a weighted Cohen’s kappa of 0.929 (95% confidence interval (CI) = 0.878; 0.981). CONCLUSION: The SDAI-Q showed an absolute agreement regarding the assignment of disease activity categories in comparison with the conventional SDAI. Therefore, the SDAI-Q may facilitate the application of a treat-to-target concept in clinical trials and clinical routine as a quickly available disease activity score incorporating CRP as an objective parameter. SAGE Publications 2022-08-16 /pmc/articles/PMC9393358/ /pubmed/36003590 http://dx.doi.org/10.1177/1759720X221114107 Text en © The Author(s), 2022 https://creativecommons.org/licenses/by-nc/4.0/This article is distributed under the terms of the Creative Commons Attribution-NonCommercial 4.0 License (https://creativecommons.org/licenses/by-nc/4.0/) which permits non-commercial use, reproduction and distribution of the work without further permission provided the original work is attributed as specified on the SAGE and Open Access page (https://us.sagepub.com/en-us/nam/open-access-at-sage). |
spellingShingle | Original Research Schally, Julia Brandt, Henning Christian Brandt-Jürgens, Jan Burmester, Gerd R. Haibel, Hildrun Käding, Henriette Karberg, Kirsten Lüders, Susanne Muche, Burkhard Protopopov, Mikhail Rios Rodriguez, Valeria Torgutalp, Murat Verba, Maryna Zinke, Silke Poddubnyy, Denis Proft, Fabian Validation of the Simplified Disease Activity Index (SDAI) with a quick quantitative C-reactive protein assay (SDAI-Q) in patients with rheumatoid arthritis: a prospective multicenter cross-sectional study |
title | Validation of the Simplified Disease Activity Index (SDAI) with a
quick quantitative C-reactive protein assay (SDAI-Q) in patients with rheumatoid
arthritis: a prospective multicenter cross-sectional study |
title_full | Validation of the Simplified Disease Activity Index (SDAI) with a
quick quantitative C-reactive protein assay (SDAI-Q) in patients with rheumatoid
arthritis: a prospective multicenter cross-sectional study |
title_fullStr | Validation of the Simplified Disease Activity Index (SDAI) with a
quick quantitative C-reactive protein assay (SDAI-Q) in patients with rheumatoid
arthritis: a prospective multicenter cross-sectional study |
title_full_unstemmed | Validation of the Simplified Disease Activity Index (SDAI) with a
quick quantitative C-reactive protein assay (SDAI-Q) in patients with rheumatoid
arthritis: a prospective multicenter cross-sectional study |
title_short | Validation of the Simplified Disease Activity Index (SDAI) with a
quick quantitative C-reactive protein assay (SDAI-Q) in patients with rheumatoid
arthritis: a prospective multicenter cross-sectional study |
title_sort | validation of the simplified disease activity index (sdai) with a
quick quantitative c-reactive protein assay (sdai-q) in patients with rheumatoid
arthritis: a prospective multicenter cross-sectional study |
topic | Original Research |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9393358/ https://www.ncbi.nlm.nih.gov/pubmed/36003590 http://dx.doi.org/10.1177/1759720X221114107 |
work_keys_str_mv | AT schallyjulia validationofthesimplifieddiseaseactivityindexsdaiwithaquickquantitativecreactiveproteinassaysdaiqinpatientswithrheumatoidarthritisaprospectivemulticentercrosssectionalstudy AT brandthenningchristian validationofthesimplifieddiseaseactivityindexsdaiwithaquickquantitativecreactiveproteinassaysdaiqinpatientswithrheumatoidarthritisaprospectivemulticentercrosssectionalstudy AT brandtjurgensjan validationofthesimplifieddiseaseactivityindexsdaiwithaquickquantitativecreactiveproteinassaysdaiqinpatientswithrheumatoidarthritisaprospectivemulticentercrosssectionalstudy AT burmestergerdr validationofthesimplifieddiseaseactivityindexsdaiwithaquickquantitativecreactiveproteinassaysdaiqinpatientswithrheumatoidarthritisaprospectivemulticentercrosssectionalstudy AT haibelhildrun validationofthesimplifieddiseaseactivityindexsdaiwithaquickquantitativecreactiveproteinassaysdaiqinpatientswithrheumatoidarthritisaprospectivemulticentercrosssectionalstudy AT kadinghenriette validationofthesimplifieddiseaseactivityindexsdaiwithaquickquantitativecreactiveproteinassaysdaiqinpatientswithrheumatoidarthritisaprospectivemulticentercrosssectionalstudy AT karbergkirsten validationofthesimplifieddiseaseactivityindexsdaiwithaquickquantitativecreactiveproteinassaysdaiqinpatientswithrheumatoidarthritisaprospectivemulticentercrosssectionalstudy AT luderssusanne validationofthesimplifieddiseaseactivityindexsdaiwithaquickquantitativecreactiveproteinassaysdaiqinpatientswithrheumatoidarthritisaprospectivemulticentercrosssectionalstudy AT mucheburkhard validationofthesimplifieddiseaseactivityindexsdaiwithaquickquantitativecreactiveproteinassaysdaiqinpatientswithrheumatoidarthritisaprospectivemulticentercrosssectionalstudy AT protopopovmikhail validationofthesimplifieddiseaseactivityindexsdaiwithaquickquantitativecreactiveproteinassaysdaiqinpatientswithrheumatoidarthritisaprospectivemulticentercrosssectionalstudy AT riosrodriguezvaleria validationofthesimplifieddiseaseactivityindexsdaiwithaquickquantitativecreactiveproteinassaysdaiqinpatientswithrheumatoidarthritisaprospectivemulticentercrosssectionalstudy AT torgutalpmurat validationofthesimplifieddiseaseactivityindexsdaiwithaquickquantitativecreactiveproteinassaysdaiqinpatientswithrheumatoidarthritisaprospectivemulticentercrosssectionalstudy AT verbamaryna validationofthesimplifieddiseaseactivityindexsdaiwithaquickquantitativecreactiveproteinassaysdaiqinpatientswithrheumatoidarthritisaprospectivemulticentercrosssectionalstudy AT zinkesilke validationofthesimplifieddiseaseactivityindexsdaiwithaquickquantitativecreactiveproteinassaysdaiqinpatientswithrheumatoidarthritisaprospectivemulticentercrosssectionalstudy AT poddubnyydenis validationofthesimplifieddiseaseactivityindexsdaiwithaquickquantitativecreactiveproteinassaysdaiqinpatientswithrheumatoidarthritisaprospectivemulticentercrosssectionalstudy AT proftfabian validationofthesimplifieddiseaseactivityindexsdaiwithaquickquantitativecreactiveproteinassaysdaiqinpatientswithrheumatoidarthritisaprospectivemulticentercrosssectionalstudy |