Cargando…

Recognition memory, primacy vs. recency effects, and time perception in the online version of the fear of scream paradigm

Anxiety disorders are characterized by cognitive dysfunctions which contribute to the patient’s profound disabilities. The threat of shock paradigm represents a validated psychopathological model of anxiety to measure the impact of anxiety on cognitive processes. We have developed an online version...

Descripción completa

Detalles Bibliográficos
Autores principales: Zlomuzica, Armin, Kullmann, Fine, Hesse, Julia, Plank, Laurin, Dere, Ekrem
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Nature Publishing Group UK 2022
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9395394/
https://www.ncbi.nlm.nih.gov/pubmed/35995804
http://dx.doi.org/10.1038/s41598-022-18124-9
_version_ 1784771683192668160
author Zlomuzica, Armin
Kullmann, Fine
Hesse, Julia
Plank, Laurin
Dere, Ekrem
author_facet Zlomuzica, Armin
Kullmann, Fine
Hesse, Julia
Plank, Laurin
Dere, Ekrem
author_sort Zlomuzica, Armin
collection PubMed
description Anxiety disorders are characterized by cognitive dysfunctions which contribute to the patient’s profound disabilities. The threat of shock paradigm represents a validated psychopathological model of anxiety to measure the impact of anxiety on cognitive processes. We have developed an online version of the threat of scream paradigm (ToSP) to investigate the impact of experimental anxiety on recognition memory. Two animated passive walkthrough videos (either under threat of scream or safety conditions) were shown to healthy participants. Recognition memory, primacy vs. recency effects, and subjective estimations of the length of encoding sessions were assessed. Subjective anxiety, stress, and emotional arousal ratings indicated that experimental anxiety could successfully be induced (Safe-Threat) or reversed (Threat-Safe) between the two passive walkthrough sessions. Participants exposed to distress screams showed impaired retrieval of complex information that has been presented in an animated environment. In the threat condition, participants failed to recognize details related to the persons encountered, their spatial locations, as well as information about the temporal order and sequence of encounters. Participant groups, which received a threat announcement prior to the first walkthrough session (Threat-Threat vs. Safety-Safety and Threat-Safety vs. Safety-Threat) showed poorer recognition memory as compared to the groups that received a safety announcement (P = 0.0468 and P = 0.0426, respectively; Mann–Whitney U test, Cohen’s d = 0.5071; effect size r = 0.2458). In conclusion, experimental anxiety induced by the online version of the ToSP leads to compromised recognition memory for complex multi-dimensional information. Our results indicate that cognitive functions of vulnerable populations (with limited mobility) can be evaluated online by means of the ToSP.
format Online
Article
Text
id pubmed-9395394
institution National Center for Biotechnology Information
language English
publishDate 2022
publisher Nature Publishing Group UK
record_format MEDLINE/PubMed
spelling pubmed-93953942022-08-24 Recognition memory, primacy vs. recency effects, and time perception in the online version of the fear of scream paradigm Zlomuzica, Armin Kullmann, Fine Hesse, Julia Plank, Laurin Dere, Ekrem Sci Rep Article Anxiety disorders are characterized by cognitive dysfunctions which contribute to the patient’s profound disabilities. The threat of shock paradigm represents a validated psychopathological model of anxiety to measure the impact of anxiety on cognitive processes. We have developed an online version of the threat of scream paradigm (ToSP) to investigate the impact of experimental anxiety on recognition memory. Two animated passive walkthrough videos (either under threat of scream or safety conditions) were shown to healthy participants. Recognition memory, primacy vs. recency effects, and subjective estimations of the length of encoding sessions were assessed. Subjective anxiety, stress, and emotional arousal ratings indicated that experimental anxiety could successfully be induced (Safe-Threat) or reversed (Threat-Safe) between the two passive walkthrough sessions. Participants exposed to distress screams showed impaired retrieval of complex information that has been presented in an animated environment. In the threat condition, participants failed to recognize details related to the persons encountered, their spatial locations, as well as information about the temporal order and sequence of encounters. Participant groups, which received a threat announcement prior to the first walkthrough session (Threat-Threat vs. Safety-Safety and Threat-Safety vs. Safety-Threat) showed poorer recognition memory as compared to the groups that received a safety announcement (P = 0.0468 and P = 0.0426, respectively; Mann–Whitney U test, Cohen’s d = 0.5071; effect size r = 0.2458). In conclusion, experimental anxiety induced by the online version of the ToSP leads to compromised recognition memory for complex multi-dimensional information. Our results indicate that cognitive functions of vulnerable populations (with limited mobility) can be evaluated online by means of the ToSP. Nature Publishing Group UK 2022-08-22 /pmc/articles/PMC9395394/ /pubmed/35995804 http://dx.doi.org/10.1038/s41598-022-18124-9 Text en © The Author(s) 2022 https://creativecommons.org/licenses/by/4.0/Open Access This article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) .
spellingShingle Article
Zlomuzica, Armin
Kullmann, Fine
Hesse, Julia
Plank, Laurin
Dere, Ekrem
Recognition memory, primacy vs. recency effects, and time perception in the online version of the fear of scream paradigm
title Recognition memory, primacy vs. recency effects, and time perception in the online version of the fear of scream paradigm
title_full Recognition memory, primacy vs. recency effects, and time perception in the online version of the fear of scream paradigm
title_fullStr Recognition memory, primacy vs. recency effects, and time perception in the online version of the fear of scream paradigm
title_full_unstemmed Recognition memory, primacy vs. recency effects, and time perception in the online version of the fear of scream paradigm
title_short Recognition memory, primacy vs. recency effects, and time perception in the online version of the fear of scream paradigm
title_sort recognition memory, primacy vs. recency effects, and time perception in the online version of the fear of scream paradigm
topic Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9395394/
https://www.ncbi.nlm.nih.gov/pubmed/35995804
http://dx.doi.org/10.1038/s41598-022-18124-9
work_keys_str_mv AT zlomuzicaarmin recognitionmemoryprimacyvsrecencyeffectsandtimeperceptionintheonlineversionofthefearofscreamparadigm
AT kullmannfine recognitionmemoryprimacyvsrecencyeffectsandtimeperceptionintheonlineversionofthefearofscreamparadigm
AT hessejulia recognitionmemoryprimacyvsrecencyeffectsandtimeperceptionintheonlineversionofthefearofscreamparadigm
AT planklaurin recognitionmemoryprimacyvsrecencyeffectsandtimeperceptionintheonlineversionofthefearofscreamparadigm
AT dereekrem recognitionmemoryprimacyvsrecencyeffectsandtimeperceptionintheonlineversionofthefearofscreamparadigm