Cargando…
Correction: A Novel NF-κB-inducing Kinase-MAPK Signaling Pathway Up-regulates NF-κB Activity in Melanoma Cells
| Autores principales: | , |
|---|---|
| Formato: | Online Artículo Texto |
| Lenguaje: | English |
| Publicado: |
American Society for Biochemistry and Molecular Biology
2022
|
| Materias: | |
| Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9396054/ http://dx.doi.org/10.1016/j.jbc.2022.102315 |
| _version_ | 1784771843261988864 |
|---|---|
| author | Dhawan, Punita Richmond, Ann |
| author_facet | Dhawan, Punita Richmond, Ann |
| author_sort | Dhawan, Punita |
| collection | PubMed |
| description | |
| format | Online Article Text |
| id | pubmed-9396054 |
| institution | National Center for Biotechnology Information |
| language | English |
| publishDate | 2022 |
| publisher | American Society for Biochemistry and Molecular Biology |
| record_format | MEDLINE/PubMed |
| spelling | pubmed-93960542022-08-25 Correction: A Novel NF-κB-inducing Kinase-MAPK Signaling Pathway Up-regulates NF-κB Activity in Melanoma Cells Dhawan, Punita Richmond, Ann J Biol Chem Additions and Corrections American Society for Biochemistry and Molecular Biology 2022-08-12 /pmc/articles/PMC9396054/ http://dx.doi.org/10.1016/j.jbc.2022.102315 Text en © 2022 The Authors https://creativecommons.org/licenses/by/4.0/This is an open access article under the CC BY license (http://creativecommons.org/licenses/by/4.0/). |
| spellingShingle | Additions and Corrections Dhawan, Punita Richmond, Ann Correction: A Novel NF-κB-inducing Kinase-MAPK Signaling Pathway Up-regulates NF-κB Activity in Melanoma Cells |
| title | Correction: A Novel NF-κB-inducing Kinase-MAPK Signaling Pathway Up-regulates NF-κB Activity in Melanoma Cells |
| title_full | Correction: A Novel NF-κB-inducing Kinase-MAPK Signaling Pathway Up-regulates NF-κB Activity in Melanoma Cells |
| title_fullStr | Correction: A Novel NF-κB-inducing Kinase-MAPK Signaling Pathway Up-regulates NF-κB Activity in Melanoma Cells |
| title_full_unstemmed | Correction: A Novel NF-κB-inducing Kinase-MAPK Signaling Pathway Up-regulates NF-κB Activity in Melanoma Cells |
| title_short | Correction: A Novel NF-κB-inducing Kinase-MAPK Signaling Pathway Up-regulates NF-κB Activity in Melanoma Cells |
| title_sort | correction: a novel nf-κb-inducing kinase-mapk signaling pathway up-regulates nf-κb activity in melanoma cells |
| topic | Additions and Corrections |
| url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9396054/ http://dx.doi.org/10.1016/j.jbc.2022.102315 |
| work_keys_str_mv | AT dhawanpunita correctionanovelnfkbinducingkinasemapksignalingpathwayupregulatesnfkbactivityinmelanomacells AT richmondann correctionanovelnfkbinducingkinasemapksignalingpathwayupregulatesnfkbactivityinmelanomacells |