Cargando…

Evidence-Based Approaches for Determining Effective Target Antigens to Develop Vaccines against Post-Weaning Diarrhea Caused by Enterotoxigenic Escherichia coli in Pigs: A Systematic Review and Network Meta-Analysis

SIMPLE SUMMARY: Owing to the levels of mortality and morbidity associated with enterotoxigenic Escherichia coli (ETEC) inflicted diarrhea, as well as the scope of the global disease burden, several initiatives to develop effective vaccines have been launched. We conducted a meta-analysis to assess t...

Descripción completa

Detalles Bibliográficos
Autores principales: Ntakiyisumba, Eurade, Lee, Simin, Won, Gayeon
Formato: Online Artículo Texto
Lenguaje:English
Publicado: MDPI 2022
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9405027/
https://www.ncbi.nlm.nih.gov/pubmed/36009725
http://dx.doi.org/10.3390/ani12162136
_version_ 1784773778954256384
author Ntakiyisumba, Eurade
Lee, Simin
Won, Gayeon
author_facet Ntakiyisumba, Eurade
Lee, Simin
Won, Gayeon
author_sort Ntakiyisumba, Eurade
collection PubMed
description SIMPLE SUMMARY: Owing to the levels of mortality and morbidity associated with enterotoxigenic Escherichia coli (ETEC) inflicted diarrhea, as well as the scope of the global disease burden, several initiatives to develop effective vaccines have been launched. We conducted a meta-analysis to assess the efficacy of commercially available and candidate vaccines against ETEC-associated post-weaning diarrhea in pigs. The effectiveness of vaccines was evaluated using three clinical outcomes: mortality, diarrhea, and average daily weight gain. Subsequently, a simultaneous comparison of vaccines was conducted using a Bayesian network meta-analysis approach to generate evidence-based data on the most effective vaccine based on their target antigens. The results indicated that vaccinated pigs had a significantly lower risk of diarrhea and mortality when compared to non-vaccinated pigs. Furthermore, the findings also showed that a multivalent vaccine that targets both fimbriae and enterotoxins should be prioritized to combat post-weaning diarrhea in pigs. ABSTRACT: In this study, we conducted a meta-analysis (MA) and systematic review to evaluate the effectiveness of vaccines against post-weaning diarrhea (PWD), caused by enterotoxigenic Escherichia coli (ETEC), in piglets. A Bayesian network meta-analysis (NMA) was also performed to compare the effects of combining different target antigens on vaccine efficacy. Relevant electronic databases were searched using pre-specified search terms, and 17 studies were selected based on three outcomes: diarrhea, mortality, and average daily weight gain (ADWG). In pairwise MA, the vaccinated group showed a significant decrease in diarrhea (OR = 0.124 [0.056, 0.275]) and mortality (OR = 0.273 [0.165, 0.451]), and a significant increase in ADWG (SMD = 0.699 [0.107, 1.290]) compared with those in controls. Furthermore, NMA results showed that all vaccine groups, except for group D (LT enterotoxin), were effective against PWD. Rank probabilities indicated that the F4 + F18 + LT combination was the best regimen for preventing diarrhea (SUCRA score = 0.92) and mortality (SUCRA score = 0.89). NMA also demonstrated that, among the vaccine groups, those inducing simultaneous anti-adhesion and antitoxin immunity had the highest efficacy. Our results provide evidence-based information on the efficacy of vaccines in reducing PWD incidence in pigs and may serve as guidelines for antigen selection for commercial vaccine development in the future.
format Online
Article
Text
id pubmed-9405027
institution National Center for Biotechnology Information
language English
publishDate 2022
publisher MDPI
record_format MEDLINE/PubMed
spelling pubmed-94050272022-08-26 Evidence-Based Approaches for Determining Effective Target Antigens to Develop Vaccines against Post-Weaning Diarrhea Caused by Enterotoxigenic Escherichia coli in Pigs: A Systematic Review and Network Meta-Analysis Ntakiyisumba, Eurade Lee, Simin Won, Gayeon Animals (Basel) Article SIMPLE SUMMARY: Owing to the levels of mortality and morbidity associated with enterotoxigenic Escherichia coli (ETEC) inflicted diarrhea, as well as the scope of the global disease burden, several initiatives to develop effective vaccines have been launched. We conducted a meta-analysis to assess the efficacy of commercially available and candidate vaccines against ETEC-associated post-weaning diarrhea in pigs. The effectiveness of vaccines was evaluated using three clinical outcomes: mortality, diarrhea, and average daily weight gain. Subsequently, a simultaneous comparison of vaccines was conducted using a Bayesian network meta-analysis approach to generate evidence-based data on the most effective vaccine based on their target antigens. The results indicated that vaccinated pigs had a significantly lower risk of diarrhea and mortality when compared to non-vaccinated pigs. Furthermore, the findings also showed that a multivalent vaccine that targets both fimbriae and enterotoxins should be prioritized to combat post-weaning diarrhea in pigs. ABSTRACT: In this study, we conducted a meta-analysis (MA) and systematic review to evaluate the effectiveness of vaccines against post-weaning diarrhea (PWD), caused by enterotoxigenic Escherichia coli (ETEC), in piglets. A Bayesian network meta-analysis (NMA) was also performed to compare the effects of combining different target antigens on vaccine efficacy. Relevant electronic databases were searched using pre-specified search terms, and 17 studies were selected based on three outcomes: diarrhea, mortality, and average daily weight gain (ADWG). In pairwise MA, the vaccinated group showed a significant decrease in diarrhea (OR = 0.124 [0.056, 0.275]) and mortality (OR = 0.273 [0.165, 0.451]), and a significant increase in ADWG (SMD = 0.699 [0.107, 1.290]) compared with those in controls. Furthermore, NMA results showed that all vaccine groups, except for group D (LT enterotoxin), were effective against PWD. Rank probabilities indicated that the F4 + F18 + LT combination was the best regimen for preventing diarrhea (SUCRA score = 0.92) and mortality (SUCRA score = 0.89). NMA also demonstrated that, among the vaccine groups, those inducing simultaneous anti-adhesion and antitoxin immunity had the highest efficacy. Our results provide evidence-based information on the efficacy of vaccines in reducing PWD incidence in pigs and may serve as guidelines for antigen selection for commercial vaccine development in the future. MDPI 2022-08-19 /pmc/articles/PMC9405027/ /pubmed/36009725 http://dx.doi.org/10.3390/ani12162136 Text en © 2022 by the authors. https://creativecommons.org/licenses/by/4.0/Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
spellingShingle Article
Ntakiyisumba, Eurade
Lee, Simin
Won, Gayeon
Evidence-Based Approaches for Determining Effective Target Antigens to Develop Vaccines against Post-Weaning Diarrhea Caused by Enterotoxigenic Escherichia coli in Pigs: A Systematic Review and Network Meta-Analysis
title Evidence-Based Approaches for Determining Effective Target Antigens to Develop Vaccines against Post-Weaning Diarrhea Caused by Enterotoxigenic Escherichia coli in Pigs: A Systematic Review and Network Meta-Analysis
title_full Evidence-Based Approaches for Determining Effective Target Antigens to Develop Vaccines against Post-Weaning Diarrhea Caused by Enterotoxigenic Escherichia coli in Pigs: A Systematic Review and Network Meta-Analysis
title_fullStr Evidence-Based Approaches for Determining Effective Target Antigens to Develop Vaccines against Post-Weaning Diarrhea Caused by Enterotoxigenic Escherichia coli in Pigs: A Systematic Review and Network Meta-Analysis
title_full_unstemmed Evidence-Based Approaches for Determining Effective Target Antigens to Develop Vaccines against Post-Weaning Diarrhea Caused by Enterotoxigenic Escherichia coli in Pigs: A Systematic Review and Network Meta-Analysis
title_short Evidence-Based Approaches for Determining Effective Target Antigens to Develop Vaccines against Post-Weaning Diarrhea Caused by Enterotoxigenic Escherichia coli in Pigs: A Systematic Review and Network Meta-Analysis
title_sort evidence-based approaches for determining effective target antigens to develop vaccines against post-weaning diarrhea caused by enterotoxigenic escherichia coli in pigs: a systematic review and network meta-analysis
topic Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9405027/
https://www.ncbi.nlm.nih.gov/pubmed/36009725
http://dx.doi.org/10.3390/ani12162136
work_keys_str_mv AT ntakiyisumbaeurade evidencebasedapproachesfordeterminingeffectivetargetantigenstodevelopvaccinesagainstpostweaningdiarrheacausedbyenterotoxigenicescherichiacoliinpigsasystematicreviewandnetworkmetaanalysis
AT leesimin evidencebasedapproachesfordeterminingeffectivetargetantigenstodevelopvaccinesagainstpostweaningdiarrheacausedbyenterotoxigenicescherichiacoliinpigsasystematicreviewandnetworkmetaanalysis
AT wongayeon evidencebasedapproachesfordeterminingeffectivetargetantigenstodevelopvaccinesagainstpostweaningdiarrheacausedbyenterotoxigenicescherichiacoliinpigsasystematicreviewandnetworkmetaanalysis