Cargando…
Economic evaluation of physical activity mass media campaigns across the globe: a systematic review
BACKGROUND: Physical activity mass media campaigns can deliver physical activity messages to many people, but it remains unclear whether they offer good value for money. We aimed to investigate the cost-effectiveness, cost-utility, and costs of physical activity mass media campaigns. METHODS: A sear...
Autores principales: | , , , , , , , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2022
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9419405/ https://www.ncbi.nlm.nih.gov/pubmed/36028860 http://dx.doi.org/10.1186/s12966-022-01340-x |
_version_ | 1784777167620538368 |
---|---|
author | Pinheiro, Marina B. Howard, Kirsten Sherrington, Cathie Bauman, Adrian Costa, Nathalia Smith, Ben J. Bellew, William Ding, Ding Tiedemann, Anne Wang, Belinda Santos, Andreia C Bull, Fiona Willumsen, Juana Albuquerque, Bruna S. Lunar, Frances Rom Bapat, Vishwesh Norris, Sarah K. |
author_facet | Pinheiro, Marina B. Howard, Kirsten Sherrington, Cathie Bauman, Adrian Costa, Nathalia Smith, Ben J. Bellew, William Ding, Ding Tiedemann, Anne Wang, Belinda Santos, Andreia C Bull, Fiona Willumsen, Juana Albuquerque, Bruna S. Lunar, Frances Rom Bapat, Vishwesh Norris, Sarah K. |
author_sort | Pinheiro, Marina B. |
collection | PubMed |
description | BACKGROUND: Physical activity mass media campaigns can deliver physical activity messages to many people, but it remains unclear whether they offer good value for money. We aimed to investigate the cost-effectiveness, cost-utility, and costs of physical activity mass media campaigns. METHODS: A search for economic evaluations (trial- or model-based) and costing studies of physical activity mass media campaigns was performed in six electronic databases (June/2021). The authors reviewed studies independently. A GRADE style rating was used to assess the overall certainty of each modelled economic evaluation. Results were summarised via narrative synthesis. RESULTS: Twenty-five studies (five model-based economic evaluations and 20 costing studies) were included, and all were conducted in high-income countries except for one costing study that was conducted in a middle-income country. The methods and assumptions used in the model-based analyses were highly heterogeneous and the results varied, ranging from the intervention being more effective and less costly (dominant) in two models to an incremental cost of US$130,740 (2020 base year) per QALY gained. The level of certainty of the models ranged from very low (n = 2) to low (n = 3). Overall, intervention costs were poorly reported. CONCLUSIONS: There are few economic evaluations of physical activity mass media campaigns available. The level of certainty of the models was judged to be very low to low, indicating that we have very little to little confidence that the results are reliable for decision making. Therefore, it remains unclear to what extent physical activity mass media campaigns offer good value for money. Future economic evaluations should consider selecting appropriate and comprehensive measures of campaign effectiveness, clearly report the assumptions of the models and fully explore the impact of assumptions in the results. REVIEW REGISTRATION: https://bit.ly/3tKSBZ3 SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12966-022-01340-x. |
format | Online Article Text |
id | pubmed-9419405 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2022 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-94194052022-08-28 Economic evaluation of physical activity mass media campaigns across the globe: a systematic review Pinheiro, Marina B. Howard, Kirsten Sherrington, Cathie Bauman, Adrian Costa, Nathalia Smith, Ben J. Bellew, William Ding, Ding Tiedemann, Anne Wang, Belinda Santos, Andreia C Bull, Fiona Willumsen, Juana Albuquerque, Bruna S. Lunar, Frances Rom Bapat, Vishwesh Norris, Sarah K. Int J Behav Nutr Phys Act Review BACKGROUND: Physical activity mass media campaigns can deliver physical activity messages to many people, but it remains unclear whether they offer good value for money. We aimed to investigate the cost-effectiveness, cost-utility, and costs of physical activity mass media campaigns. METHODS: A search for economic evaluations (trial- or model-based) and costing studies of physical activity mass media campaigns was performed in six electronic databases (June/2021). The authors reviewed studies independently. A GRADE style rating was used to assess the overall certainty of each modelled economic evaluation. Results were summarised via narrative synthesis. RESULTS: Twenty-five studies (five model-based economic evaluations and 20 costing studies) were included, and all were conducted in high-income countries except for one costing study that was conducted in a middle-income country. The methods and assumptions used in the model-based analyses were highly heterogeneous and the results varied, ranging from the intervention being more effective and less costly (dominant) in two models to an incremental cost of US$130,740 (2020 base year) per QALY gained. The level of certainty of the models ranged from very low (n = 2) to low (n = 3). Overall, intervention costs were poorly reported. CONCLUSIONS: There are few economic evaluations of physical activity mass media campaigns available. The level of certainty of the models was judged to be very low to low, indicating that we have very little to little confidence that the results are reliable for decision making. Therefore, it remains unclear to what extent physical activity mass media campaigns offer good value for money. Future economic evaluations should consider selecting appropriate and comprehensive measures of campaign effectiveness, clearly report the assumptions of the models and fully explore the impact of assumptions in the results. REVIEW REGISTRATION: https://bit.ly/3tKSBZ3 SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12966-022-01340-x. BioMed Central 2022-08-26 /pmc/articles/PMC9419405/ /pubmed/36028860 http://dx.doi.org/10.1186/s12966-022-01340-x Text en © The Author(s) 2022 https://creativecommons.org/licenses/by/4.0/Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data. |
spellingShingle | Review Pinheiro, Marina B. Howard, Kirsten Sherrington, Cathie Bauman, Adrian Costa, Nathalia Smith, Ben J. Bellew, William Ding, Ding Tiedemann, Anne Wang, Belinda Santos, Andreia C Bull, Fiona Willumsen, Juana Albuquerque, Bruna S. Lunar, Frances Rom Bapat, Vishwesh Norris, Sarah K. Economic evaluation of physical activity mass media campaigns across the globe: a systematic review |
title | Economic evaluation of physical activity mass media campaigns across the globe: a systematic review |
title_full | Economic evaluation of physical activity mass media campaigns across the globe: a systematic review |
title_fullStr | Economic evaluation of physical activity mass media campaigns across the globe: a systematic review |
title_full_unstemmed | Economic evaluation of physical activity mass media campaigns across the globe: a systematic review |
title_short | Economic evaluation of physical activity mass media campaigns across the globe: a systematic review |
title_sort | economic evaluation of physical activity mass media campaigns across the globe: a systematic review |
topic | Review |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9419405/ https://www.ncbi.nlm.nih.gov/pubmed/36028860 http://dx.doi.org/10.1186/s12966-022-01340-x |
work_keys_str_mv | AT pinheiromarinab economicevaluationofphysicalactivitymassmediacampaignsacrosstheglobeasystematicreview AT howardkirsten economicevaluationofphysicalactivitymassmediacampaignsacrosstheglobeasystematicreview AT sherringtoncathie economicevaluationofphysicalactivitymassmediacampaignsacrosstheglobeasystematicreview AT baumanadrian economicevaluationofphysicalactivitymassmediacampaignsacrosstheglobeasystematicreview AT costanathalia economicevaluationofphysicalactivitymassmediacampaignsacrosstheglobeasystematicreview AT smithbenj economicevaluationofphysicalactivitymassmediacampaignsacrosstheglobeasystematicreview AT bellewwilliam economicevaluationofphysicalactivitymassmediacampaignsacrosstheglobeasystematicreview AT dingding economicevaluationofphysicalactivitymassmediacampaignsacrosstheglobeasystematicreview AT tiedemannanne economicevaluationofphysicalactivitymassmediacampaignsacrosstheglobeasystematicreview AT wangbelinda economicevaluationofphysicalactivitymassmediacampaignsacrosstheglobeasystematicreview AT santosandreiac economicevaluationofphysicalactivitymassmediacampaignsacrosstheglobeasystematicreview AT bullfiona economicevaluationofphysicalactivitymassmediacampaignsacrosstheglobeasystematicreview AT willumsenjuana economicevaluationofphysicalactivitymassmediacampaignsacrosstheglobeasystematicreview AT albuquerquebrunas economicevaluationofphysicalactivitymassmediacampaignsacrosstheglobeasystematicreview AT lunarfrancesrom economicevaluationofphysicalactivitymassmediacampaignsacrosstheglobeasystematicreview AT bapatvishwesh economicevaluationofphysicalactivitymassmediacampaignsacrosstheglobeasystematicreview AT norrissarahk economicevaluationofphysicalactivitymassmediacampaignsacrosstheglobeasystematicreview |