Cargando…

Economic evaluation of physical activity mass media campaigns across the globe: a systematic review

BACKGROUND: Physical activity mass media campaigns can deliver physical activity messages to many people, but it remains unclear whether they offer good value for money. We aimed to investigate the cost-effectiveness, cost-utility, and costs of physical activity mass media campaigns. METHODS: A sear...

Descripción completa

Detalles Bibliográficos
Autores principales: Pinheiro, Marina B., Howard, Kirsten, Sherrington, Cathie, Bauman, Adrian, Costa, Nathalia, Smith, Ben J., Bellew, William, Ding, Ding, Tiedemann, Anne, Wang, Belinda, Santos, Andreia C, Bull, Fiona, Willumsen, Juana, Albuquerque, Bruna S., Lunar, Frances Rom, Bapat, Vishwesh, Norris, Sarah K.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2022
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9419405/
https://www.ncbi.nlm.nih.gov/pubmed/36028860
http://dx.doi.org/10.1186/s12966-022-01340-x
_version_ 1784777167620538368
author Pinheiro, Marina B.
Howard, Kirsten
Sherrington, Cathie
Bauman, Adrian
Costa, Nathalia
Smith, Ben J.
Bellew, William
Ding, Ding
Tiedemann, Anne
Wang, Belinda
Santos, Andreia C
Bull, Fiona
Willumsen, Juana
Albuquerque, Bruna S.
Lunar, Frances Rom
Bapat, Vishwesh
Norris, Sarah K.
author_facet Pinheiro, Marina B.
Howard, Kirsten
Sherrington, Cathie
Bauman, Adrian
Costa, Nathalia
Smith, Ben J.
Bellew, William
Ding, Ding
Tiedemann, Anne
Wang, Belinda
Santos, Andreia C
Bull, Fiona
Willumsen, Juana
Albuquerque, Bruna S.
Lunar, Frances Rom
Bapat, Vishwesh
Norris, Sarah K.
author_sort Pinheiro, Marina B.
collection PubMed
description BACKGROUND: Physical activity mass media campaigns can deliver physical activity messages to many people, but it remains unclear whether they offer good value for money. We aimed to investigate the cost-effectiveness, cost-utility, and costs of physical activity mass media campaigns. METHODS: A search for economic evaluations (trial- or model-based) and costing studies of physical activity mass media campaigns was performed in six electronic databases (June/2021). The authors reviewed studies independently. A GRADE style rating was used to assess the overall certainty of each modelled economic evaluation. Results were summarised via narrative synthesis. RESULTS: Twenty-five studies (five model-based economic evaluations and 20 costing studies) were included, and all were conducted in high-income countries except for one costing study that was conducted in a middle-income country. The methods and assumptions used in the model-based analyses were highly heterogeneous and the results varied, ranging from the intervention being more effective and less costly (dominant) in two models to an incremental cost of US$130,740 (2020 base year) per QALY gained. The level of certainty of the models ranged from very low (n = 2) to low (n = 3). Overall, intervention costs were poorly reported. CONCLUSIONS: There are few economic evaluations of physical activity mass media campaigns available. The level of certainty of the models was judged to be very low to low, indicating that we have very little to little confidence that the results are reliable for decision making. Therefore, it remains unclear to what extent physical activity mass media campaigns offer good value for money. Future economic evaluations should consider selecting appropriate and comprehensive measures of campaign effectiveness, clearly report the assumptions of the models and fully explore the impact of assumptions in the results. REVIEW REGISTRATION: https://bit.ly/3tKSBZ3 SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12966-022-01340-x.
format Online
Article
Text
id pubmed-9419405
institution National Center for Biotechnology Information
language English
publishDate 2022
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-94194052022-08-28 Economic evaluation of physical activity mass media campaigns across the globe: a systematic review Pinheiro, Marina B. Howard, Kirsten Sherrington, Cathie Bauman, Adrian Costa, Nathalia Smith, Ben J. Bellew, William Ding, Ding Tiedemann, Anne Wang, Belinda Santos, Andreia C Bull, Fiona Willumsen, Juana Albuquerque, Bruna S. Lunar, Frances Rom Bapat, Vishwesh Norris, Sarah K. Int J Behav Nutr Phys Act Review BACKGROUND: Physical activity mass media campaigns can deliver physical activity messages to many people, but it remains unclear whether they offer good value for money. We aimed to investigate the cost-effectiveness, cost-utility, and costs of physical activity mass media campaigns. METHODS: A search for economic evaluations (trial- or model-based) and costing studies of physical activity mass media campaigns was performed in six electronic databases (June/2021). The authors reviewed studies independently. A GRADE style rating was used to assess the overall certainty of each modelled economic evaluation. Results were summarised via narrative synthesis. RESULTS: Twenty-five studies (five model-based economic evaluations and 20 costing studies) were included, and all were conducted in high-income countries except for one costing study that was conducted in a middle-income country. The methods and assumptions used in the model-based analyses were highly heterogeneous and the results varied, ranging from the intervention being more effective and less costly (dominant) in two models to an incremental cost of US$130,740 (2020 base year) per QALY gained. The level of certainty of the models ranged from very low (n = 2) to low (n = 3). Overall, intervention costs were poorly reported. CONCLUSIONS: There are few economic evaluations of physical activity mass media campaigns available. The level of certainty of the models was judged to be very low to low, indicating that we have very little to little confidence that the results are reliable for decision making. Therefore, it remains unclear to what extent physical activity mass media campaigns offer good value for money. Future economic evaluations should consider selecting appropriate and comprehensive measures of campaign effectiveness, clearly report the assumptions of the models and fully explore the impact of assumptions in the results. REVIEW REGISTRATION: https://bit.ly/3tKSBZ3 SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12966-022-01340-x. BioMed Central 2022-08-26 /pmc/articles/PMC9419405/ /pubmed/36028860 http://dx.doi.org/10.1186/s12966-022-01340-x Text en © The Author(s) 2022 https://creativecommons.org/licenses/by/4.0/Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data.
spellingShingle Review
Pinheiro, Marina B.
Howard, Kirsten
Sherrington, Cathie
Bauman, Adrian
Costa, Nathalia
Smith, Ben J.
Bellew, William
Ding, Ding
Tiedemann, Anne
Wang, Belinda
Santos, Andreia C
Bull, Fiona
Willumsen, Juana
Albuquerque, Bruna S.
Lunar, Frances Rom
Bapat, Vishwesh
Norris, Sarah K.
Economic evaluation of physical activity mass media campaigns across the globe: a systematic review
title Economic evaluation of physical activity mass media campaigns across the globe: a systematic review
title_full Economic evaluation of physical activity mass media campaigns across the globe: a systematic review
title_fullStr Economic evaluation of physical activity mass media campaigns across the globe: a systematic review
title_full_unstemmed Economic evaluation of physical activity mass media campaigns across the globe: a systematic review
title_short Economic evaluation of physical activity mass media campaigns across the globe: a systematic review
title_sort economic evaluation of physical activity mass media campaigns across the globe: a systematic review
topic Review
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9419405/
https://www.ncbi.nlm.nih.gov/pubmed/36028860
http://dx.doi.org/10.1186/s12966-022-01340-x
work_keys_str_mv AT pinheiromarinab economicevaluationofphysicalactivitymassmediacampaignsacrosstheglobeasystematicreview
AT howardkirsten economicevaluationofphysicalactivitymassmediacampaignsacrosstheglobeasystematicreview
AT sherringtoncathie economicevaluationofphysicalactivitymassmediacampaignsacrosstheglobeasystematicreview
AT baumanadrian economicevaluationofphysicalactivitymassmediacampaignsacrosstheglobeasystematicreview
AT costanathalia economicevaluationofphysicalactivitymassmediacampaignsacrosstheglobeasystematicreview
AT smithbenj economicevaluationofphysicalactivitymassmediacampaignsacrosstheglobeasystematicreview
AT bellewwilliam economicevaluationofphysicalactivitymassmediacampaignsacrosstheglobeasystematicreview
AT dingding economicevaluationofphysicalactivitymassmediacampaignsacrosstheglobeasystematicreview
AT tiedemannanne economicevaluationofphysicalactivitymassmediacampaignsacrosstheglobeasystematicreview
AT wangbelinda economicevaluationofphysicalactivitymassmediacampaignsacrosstheglobeasystematicreview
AT santosandreiac economicevaluationofphysicalactivitymassmediacampaignsacrosstheglobeasystematicreview
AT bullfiona economicevaluationofphysicalactivitymassmediacampaignsacrosstheglobeasystematicreview
AT willumsenjuana economicevaluationofphysicalactivitymassmediacampaignsacrosstheglobeasystematicreview
AT albuquerquebrunas economicevaluationofphysicalactivitymassmediacampaignsacrosstheglobeasystematicreview
AT lunarfrancesrom economicevaluationofphysicalactivitymassmediacampaignsacrosstheglobeasystematicreview
AT bapatvishwesh economicevaluationofphysicalactivitymassmediacampaignsacrosstheglobeasystematicreview
AT norrissarahk economicevaluationofphysicalactivitymassmediacampaignsacrosstheglobeasystematicreview