Cargando…

Occurrence of claw asymmetries in fattening pigs and potential impact on the development of sole ulcerations

BACKGROUND: Claw abnormalities, particularly claw asymmetries, are associated with lameness in pigs and can be a welfare issue. However, the prevalence and development of claw asymmetries in pigs of different age is unknown. Therefore, the aim of this study was to analyze the claw symmetry over the...

Descripción completa

Detalles Bibliográficos
Autores principales: Seufert, Sarah, Volkmann, Nina, Schmidt-Mosig, Johannes, Kemper, Nicole
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2022
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9422118/
https://www.ncbi.nlm.nih.gov/pubmed/36038920
http://dx.doi.org/10.1186/s40813-022-00281-y
_version_ 1784777744300638208
author Seufert, Sarah
Volkmann, Nina
Schmidt-Mosig, Johannes
Kemper, Nicole
author_facet Seufert, Sarah
Volkmann, Nina
Schmidt-Mosig, Johannes
Kemper, Nicole
author_sort Seufert, Sarah
collection PubMed
description BACKGROUND: Claw abnormalities, particularly claw asymmetries, are associated with lameness in pigs and can be a welfare issue. However, the prevalence and development of claw asymmetries in pigs of different age is unknown. Therefore, the aim of this study was to analyze the claw symmetry over the pig lifetime from birth to slaughter as well as the occurrence of sole ulcerations in fattening pigs possibly caused by such asymmetric claws. RESULTS: From third day of life until slaughtering, asymmetric growth of the claws was detected more frequently and more severely with increasing age as determined by three-step scoring. Sole ulcerations were detected in slaughtered pigs only with a prevalence of 64.2% (197/307 examined animals). The risk for a sole ulceration was 3.6-fold higher for pigs with strongly asymmetric claws (≥ 30% size difference of the claw footing area) compared to slightly asymmetric claws (≥ 5–15% size difference of the claw footing area) (odds ratio (OR) = 3.6). It was even higher for pigs showing intermediately asymmetric claws (≥ 15–30% size difference of the claw footing area) (OR = 2.7). CONCLUSIONS: The study showed a significant increase in the prevalence of claw asymmetries over the pigs’ lifetime, which can lead to serious pathologic findings with increasing age such as sole ulcerations. Most likely, the unbalanced weight load on single claws in combination with hard flooring can result in claw damages. Moreover, a genetic component cannot be excluded because claw asymmetries were already detected in suckling piglets.
format Online
Article
Text
id pubmed-9422118
institution National Center for Biotechnology Information
language English
publishDate 2022
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-94221182022-08-30 Occurrence of claw asymmetries in fattening pigs and potential impact on the development of sole ulcerations Seufert, Sarah Volkmann, Nina Schmidt-Mosig, Johannes Kemper, Nicole Porcine Health Manag Research BACKGROUND: Claw abnormalities, particularly claw asymmetries, are associated with lameness in pigs and can be a welfare issue. However, the prevalence and development of claw asymmetries in pigs of different age is unknown. Therefore, the aim of this study was to analyze the claw symmetry over the pig lifetime from birth to slaughter as well as the occurrence of sole ulcerations in fattening pigs possibly caused by such asymmetric claws. RESULTS: From third day of life until slaughtering, asymmetric growth of the claws was detected more frequently and more severely with increasing age as determined by three-step scoring. Sole ulcerations were detected in slaughtered pigs only with a prevalence of 64.2% (197/307 examined animals). The risk for a sole ulceration was 3.6-fold higher for pigs with strongly asymmetric claws (≥ 30% size difference of the claw footing area) compared to slightly asymmetric claws (≥ 5–15% size difference of the claw footing area) (odds ratio (OR) = 3.6). It was even higher for pigs showing intermediately asymmetric claws (≥ 15–30% size difference of the claw footing area) (OR = 2.7). CONCLUSIONS: The study showed a significant increase in the prevalence of claw asymmetries over the pigs’ lifetime, which can lead to serious pathologic findings with increasing age such as sole ulcerations. Most likely, the unbalanced weight load on single claws in combination with hard flooring can result in claw damages. Moreover, a genetic component cannot be excluded because claw asymmetries were already detected in suckling piglets. BioMed Central 2022-08-29 /pmc/articles/PMC9422118/ /pubmed/36038920 http://dx.doi.org/10.1186/s40813-022-00281-y Text en © The Author(s) 2022 https://creativecommons.org/licenses/by/4.0/Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data.
spellingShingle Research
Seufert, Sarah
Volkmann, Nina
Schmidt-Mosig, Johannes
Kemper, Nicole
Occurrence of claw asymmetries in fattening pigs and potential impact on the development of sole ulcerations
title Occurrence of claw asymmetries in fattening pigs and potential impact on the development of sole ulcerations
title_full Occurrence of claw asymmetries in fattening pigs and potential impact on the development of sole ulcerations
title_fullStr Occurrence of claw asymmetries in fattening pigs and potential impact on the development of sole ulcerations
title_full_unstemmed Occurrence of claw asymmetries in fattening pigs and potential impact on the development of sole ulcerations
title_short Occurrence of claw asymmetries in fattening pigs and potential impact on the development of sole ulcerations
title_sort occurrence of claw asymmetries in fattening pigs and potential impact on the development of sole ulcerations
topic Research
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9422118/
https://www.ncbi.nlm.nih.gov/pubmed/36038920
http://dx.doi.org/10.1186/s40813-022-00281-y
work_keys_str_mv AT seufertsarah occurrenceofclawasymmetriesinfatteningpigsandpotentialimpactonthedevelopmentofsoleulcerations
AT volkmannnina occurrenceofclawasymmetriesinfatteningpigsandpotentialimpactonthedevelopmentofsoleulcerations
AT schmidtmosigjohannes occurrenceofclawasymmetriesinfatteningpigsandpotentialimpactonthedevelopmentofsoleulcerations
AT kempernicole occurrenceofclawasymmetriesinfatteningpigsandpotentialimpactonthedevelopmentofsoleulcerations