Cargando…
Delayed diagnosis of complex glycerol kinase deficiency in a Chinese male infant: a case report
BACKGROUND: Xp21 contiguous gene deletion syndrome is a rare genetic metabolic disorder with poor prognosis in infants, involving deletions of one or more genes in Xp21. When deletions of adrenal hypoplasia (AHC), Duchenne muscular dystrophy (DMD), and chronic granulomatosis (CGD) loci are included,...
Autores principales: | , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2022
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9434940/ https://www.ncbi.nlm.nih.gov/pubmed/36050749 http://dx.doi.org/10.1186/s12887-022-03568-9 |
_version_ | 1784780994960687104 |
---|---|
author | Tao, Na Liu, Xiaomei Chen, Yueqi Sun, Meiyuan Xu, Fang Su, Yanfang |
author_facet | Tao, Na Liu, Xiaomei Chen, Yueqi Sun, Meiyuan Xu, Fang Su, Yanfang |
author_sort | Tao, Na |
collection | PubMed |
description | BACKGROUND: Xp21 contiguous gene deletion syndrome is a rare genetic metabolic disorder with poor prognosis in infants, involving deletions of one or more genes in Xp21. When deletions of adrenal hypoplasia (AHC), Duchenne muscular dystrophy (DMD), and chronic granulomatosis (CGD) loci are included, complex glycerol kinase deficiency (CGKD) can be diagnosed. We present a case of CGKD that was initially misdiagnosed and died during treatment in our hospital in terms of improving our understanding of the clinical features and diagnosis of this disease, as well as highlighting the need for more precise dosing of corticosteroid replacement therapy. CASE PRESENTATION: A 48-day-old full-term male infant was transferred to our medical center with global growth delay and persistent vomiting. Routine laboratory tests revealed hyperkalemia, hyponatremia, and a high level of creatine kinase. The initial diagnosis was adrenal cortical hyperplasia (ACH), then revised to adrenocortical insufficiency with a normal level of ACTH detected. After supplementing the routine lipid test and urinary glycerol test, CGKD was diagnosed clinically due to positive triglyceridemia and urinary glycerol, and the follow-up gene screening further confirmed the diagnosis. The boy kept thriving after corticosteroid replacement and salt supplementation. While levels of serum ACTH and cortisol decreased and remained low after corticosteroid replacement was administered. The patient died of acute type 2 respiratory failure and hypoglycemia after an acute upper respiratory tract infection, which may be the result of adrenal crisis after infection. Infants with CGKD have a poor prognosis, so physicians should administer regular follow-ups, and parents counseling during treatment to improve the survival of patients. CONCLUSIONS: Overall, CGKD, although rare, cannot be easily excluded in children with persistent vomiting. Extensive blood tests can help to detect abnormal indicators. Adrenal crisis needs to be avoided as much as possible during corticosteroid replacement therapy. |
format | Online Article Text |
id | pubmed-9434940 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2022 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-94349402022-09-02 Delayed diagnosis of complex glycerol kinase deficiency in a Chinese male infant: a case report Tao, Na Liu, Xiaomei Chen, Yueqi Sun, Meiyuan Xu, Fang Su, Yanfang BMC Pediatr Case Report BACKGROUND: Xp21 contiguous gene deletion syndrome is a rare genetic metabolic disorder with poor prognosis in infants, involving deletions of one or more genes in Xp21. When deletions of adrenal hypoplasia (AHC), Duchenne muscular dystrophy (DMD), and chronic granulomatosis (CGD) loci are included, complex glycerol kinase deficiency (CGKD) can be diagnosed. We present a case of CGKD that was initially misdiagnosed and died during treatment in our hospital in terms of improving our understanding of the clinical features and diagnosis of this disease, as well as highlighting the need for more precise dosing of corticosteroid replacement therapy. CASE PRESENTATION: A 48-day-old full-term male infant was transferred to our medical center with global growth delay and persistent vomiting. Routine laboratory tests revealed hyperkalemia, hyponatremia, and a high level of creatine kinase. The initial diagnosis was adrenal cortical hyperplasia (ACH), then revised to adrenocortical insufficiency with a normal level of ACTH detected. After supplementing the routine lipid test and urinary glycerol test, CGKD was diagnosed clinically due to positive triglyceridemia and urinary glycerol, and the follow-up gene screening further confirmed the diagnosis. The boy kept thriving after corticosteroid replacement and salt supplementation. While levels of serum ACTH and cortisol decreased and remained low after corticosteroid replacement was administered. The patient died of acute type 2 respiratory failure and hypoglycemia after an acute upper respiratory tract infection, which may be the result of adrenal crisis after infection. Infants with CGKD have a poor prognosis, so physicians should administer regular follow-ups, and parents counseling during treatment to improve the survival of patients. CONCLUSIONS: Overall, CGKD, although rare, cannot be easily excluded in children with persistent vomiting. Extensive blood tests can help to detect abnormal indicators. Adrenal crisis needs to be avoided as much as possible during corticosteroid replacement therapy. BioMed Central 2022-09-01 /pmc/articles/PMC9434940/ /pubmed/36050749 http://dx.doi.org/10.1186/s12887-022-03568-9 Text en © The Author(s) 2022 https://creativecommons.org/licenses/by/4.0/Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data. |
spellingShingle | Case Report Tao, Na Liu, Xiaomei Chen, Yueqi Sun, Meiyuan Xu, Fang Su, Yanfang Delayed diagnosis of complex glycerol kinase deficiency in a Chinese male infant: a case report |
title | Delayed diagnosis of complex glycerol kinase deficiency in a Chinese male infant: a case report |
title_full | Delayed diagnosis of complex glycerol kinase deficiency in a Chinese male infant: a case report |
title_fullStr | Delayed diagnosis of complex glycerol kinase deficiency in a Chinese male infant: a case report |
title_full_unstemmed | Delayed diagnosis of complex glycerol kinase deficiency in a Chinese male infant: a case report |
title_short | Delayed diagnosis of complex glycerol kinase deficiency in a Chinese male infant: a case report |
title_sort | delayed diagnosis of complex glycerol kinase deficiency in a chinese male infant: a case report |
topic | Case Report |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9434940/ https://www.ncbi.nlm.nih.gov/pubmed/36050749 http://dx.doi.org/10.1186/s12887-022-03568-9 |
work_keys_str_mv | AT taona delayeddiagnosisofcomplexglycerolkinasedeficiencyinachinesemaleinfantacasereport AT liuxiaomei delayeddiagnosisofcomplexglycerolkinasedeficiencyinachinesemaleinfantacasereport AT chenyueqi delayeddiagnosisofcomplexglycerolkinasedeficiencyinachinesemaleinfantacasereport AT sunmeiyuan delayeddiagnosisofcomplexglycerolkinasedeficiencyinachinesemaleinfantacasereport AT xufang delayeddiagnosisofcomplexglycerolkinasedeficiencyinachinesemaleinfantacasereport AT suyanfang delayeddiagnosisofcomplexglycerolkinasedeficiencyinachinesemaleinfantacasereport |