Cargando…

Prevalence and significance of incidental findings on 68 Ga-DOTA-conjugated somatostatin receptor-targeting peptide PET/CT: a systematic review of the literature

AIM: We aimed to evaluate the prevalence of incidental (68) Ga-DOTA-conjugated somatostatin receptor-targeting peptide PET/CT (SSTR PET/CT) findings, their clinical significance in the need for follow-up, and their risk of malignancy. MATERIALS AND METHODS: Studies reporting incidental SSTR PET/CT f...

Descripción completa

Detalles Bibliográficos
Autores principales: Bentestuen, Morten, Gossili, Farid, Almasi, Charlotte Elberling, Zacho, Helle Damgaard
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2022
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9441055/
https://www.ncbi.nlm.nih.gov/pubmed/36057635
http://dx.doi.org/10.1186/s40644-022-00484-0
_version_ 1784782493757472768
author Bentestuen, Morten
Gossili, Farid
Almasi, Charlotte Elberling
Zacho, Helle Damgaard
author_facet Bentestuen, Morten
Gossili, Farid
Almasi, Charlotte Elberling
Zacho, Helle Damgaard
author_sort Bentestuen, Morten
collection PubMed
description AIM: We aimed to evaluate the prevalence of incidental (68) Ga-DOTA-conjugated somatostatin receptor-targeting peptide PET/CT (SSTR PET/CT) findings, their clinical significance in the need for follow-up, and their risk of malignancy. MATERIALS AND METHODS: Studies reporting incidental SSTR PET/CT findings were systematically searched in PubMed, Cochrane, Embase and Web of Science literature published prior to 1(st) of May 2020. Studies were filtered by two independent readers for eligibility based on title and abstract, and subsequently on full text. The main exclusion criteria were: 1) pathological findings that matched scan indication, 2) known organ specific disease and/or incidental findings confirmed on other scan modality prior to SSTR PET/CT, 3) lack of diagnosis and/or follow up, and 4) results published in proceedings or conference abstracts. RESULTS: Twenty-one studies, comprising a total of 2906 subjects, were eligible for the analysis. Studies included were retrospective cohort studies on incidental SSTR PET/CT findings in a specific organ (n = 2888, 7/21) or case reports (n = 18, 14/21). A total of 133 subjects had incidental SSTR PET/CT findings. Incidental findings were predominantly seen in the thyroid gland (n = 65), spine (n = 30), brain (n = 26) and breast (n = 6). Seventeen of 133 (13%) incidental findings were malignant on final diagnosis. Incidental breast findings were associated with the highest risk of malignancy (67%). In the thyroid, incidental SSTR uptake was caused by malignancy in 8%, all presenting as focal uptake. The lowest risk was seen in the spine with a malignancy rate of 3% in patients with incidental SSTR uptake and benign cases were interpreted as vertebral hemangiomas on CT. Incidental SSTR PET/CT findings in other locations were of malignant etiology in two out of six cases (33%) and should be evaluated individually. CONCLUSION: The most incidental SSTR PET/CT findings were found in the thyroid gland, spine, and brain. The risk of malignancy was greatest in incidental SSTR PET/CT findings in the breast, cranially, and thyroid gland. The results of the present study can prove useful in the interpretation of atypical findings on SSTR PET/CT and in the counseling of clinicians. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s40644-022-00484-0.
format Online
Article
Text
id pubmed-9441055
institution National Center for Biotechnology Information
language English
publishDate 2022
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-94410552022-09-05 Prevalence and significance of incidental findings on 68 Ga-DOTA-conjugated somatostatin receptor-targeting peptide PET/CT: a systematic review of the literature Bentestuen, Morten Gossili, Farid Almasi, Charlotte Elberling Zacho, Helle Damgaard Cancer Imaging Review AIM: We aimed to evaluate the prevalence of incidental (68) Ga-DOTA-conjugated somatostatin receptor-targeting peptide PET/CT (SSTR PET/CT) findings, their clinical significance in the need for follow-up, and their risk of malignancy. MATERIALS AND METHODS: Studies reporting incidental SSTR PET/CT findings were systematically searched in PubMed, Cochrane, Embase and Web of Science literature published prior to 1(st) of May 2020. Studies were filtered by two independent readers for eligibility based on title and abstract, and subsequently on full text. The main exclusion criteria were: 1) pathological findings that matched scan indication, 2) known organ specific disease and/or incidental findings confirmed on other scan modality prior to SSTR PET/CT, 3) lack of diagnosis and/or follow up, and 4) results published in proceedings or conference abstracts. RESULTS: Twenty-one studies, comprising a total of 2906 subjects, were eligible for the analysis. Studies included were retrospective cohort studies on incidental SSTR PET/CT findings in a specific organ (n = 2888, 7/21) or case reports (n = 18, 14/21). A total of 133 subjects had incidental SSTR PET/CT findings. Incidental findings were predominantly seen in the thyroid gland (n = 65), spine (n = 30), brain (n = 26) and breast (n = 6). Seventeen of 133 (13%) incidental findings were malignant on final diagnosis. Incidental breast findings were associated with the highest risk of malignancy (67%). In the thyroid, incidental SSTR uptake was caused by malignancy in 8%, all presenting as focal uptake. The lowest risk was seen in the spine with a malignancy rate of 3% in patients with incidental SSTR uptake and benign cases were interpreted as vertebral hemangiomas on CT. Incidental SSTR PET/CT findings in other locations were of malignant etiology in two out of six cases (33%) and should be evaluated individually. CONCLUSION: The most incidental SSTR PET/CT findings were found in the thyroid gland, spine, and brain. The risk of malignancy was greatest in incidental SSTR PET/CT findings in the breast, cranially, and thyroid gland. The results of the present study can prove useful in the interpretation of atypical findings on SSTR PET/CT and in the counseling of clinicians. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s40644-022-00484-0. BioMed Central 2022-09-03 /pmc/articles/PMC9441055/ /pubmed/36057635 http://dx.doi.org/10.1186/s40644-022-00484-0 Text en © The Author(s) 2022 https://creativecommons.org/licenses/by/4.0/Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data.
spellingShingle Review
Bentestuen, Morten
Gossili, Farid
Almasi, Charlotte Elberling
Zacho, Helle Damgaard
Prevalence and significance of incidental findings on 68 Ga-DOTA-conjugated somatostatin receptor-targeting peptide PET/CT: a systematic review of the literature
title Prevalence and significance of incidental findings on 68 Ga-DOTA-conjugated somatostatin receptor-targeting peptide PET/CT: a systematic review of the literature
title_full Prevalence and significance of incidental findings on 68 Ga-DOTA-conjugated somatostatin receptor-targeting peptide PET/CT: a systematic review of the literature
title_fullStr Prevalence and significance of incidental findings on 68 Ga-DOTA-conjugated somatostatin receptor-targeting peptide PET/CT: a systematic review of the literature
title_full_unstemmed Prevalence and significance of incidental findings on 68 Ga-DOTA-conjugated somatostatin receptor-targeting peptide PET/CT: a systematic review of the literature
title_short Prevalence and significance of incidental findings on 68 Ga-DOTA-conjugated somatostatin receptor-targeting peptide PET/CT: a systematic review of the literature
title_sort prevalence and significance of incidental findings on 68 ga-dota-conjugated somatostatin receptor-targeting peptide pet/ct: a systematic review of the literature
topic Review
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9441055/
https://www.ncbi.nlm.nih.gov/pubmed/36057635
http://dx.doi.org/10.1186/s40644-022-00484-0
work_keys_str_mv AT bentestuenmorten prevalenceandsignificanceofincidentalfindingson68gadotaconjugatedsomatostatinreceptortargetingpeptidepetctasystematicreviewoftheliterature
AT gossilifarid prevalenceandsignificanceofincidentalfindingson68gadotaconjugatedsomatostatinreceptortargetingpeptidepetctasystematicreviewoftheliterature
AT almasicharlotteelberling prevalenceandsignificanceofincidentalfindingson68gadotaconjugatedsomatostatinreceptortargetingpeptidepetctasystematicreviewoftheliterature
AT zachohelledamgaard prevalenceandsignificanceofincidentalfindingson68gadotaconjugatedsomatostatinreceptortargetingpeptidepetctasystematicreviewoftheliterature