Cargando…

Design and validation of a preparedness evaluation tool of pre-hospital emergency medical services for terrorist attacks: a mixed method study

INTRODUCTION: Terrorist attacks are one of the human problems that affect many countries, leaving behind a huge toll of disabilities and deaths. The aim of this study was to use a mixed-method analysis to design and validate an evaluation tool for pre-hospital emergency medical services for terroris...

Descripción completa

Detalles Bibliográficos
Autores principales: Miraki, Sadegh, Molavi-Taleghani, Yasamin, Amiresmaeili, Mohammadreza, Nekoei-Moghadam, Mahmood, Sheikhbardsiri, Hojjat
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2022
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9441090/
https://www.ncbi.nlm.nih.gov/pubmed/36057563
http://dx.doi.org/10.1186/s12873-022-00712-7
_version_ 1784782501778030592
author Miraki, Sadegh
Molavi-Taleghani, Yasamin
Amiresmaeili, Mohammadreza
Nekoei-Moghadam, Mahmood
Sheikhbardsiri, Hojjat
author_facet Miraki, Sadegh
Molavi-Taleghani, Yasamin
Amiresmaeili, Mohammadreza
Nekoei-Moghadam, Mahmood
Sheikhbardsiri, Hojjat
author_sort Miraki, Sadegh
collection PubMed
description INTRODUCTION: Terrorist attacks are one of the human problems that affect many countries, leaving behind a huge toll of disabilities and deaths. The aim of this study was to use a mixed-method analysis to design and validate an evaluation tool for pre-hospital emergency medical services for terrorist attacks. METHODS: The present study is a mixed-method (qualitative and quantitative) study that was conducted in two phases. In the qualitative phase (item generation), semi-structured interviews were conducted with 34 Iranian emergency medical technicians who were selected through a purposive sampling method and a scoping literature review was conducted to generate an item pool for the preparedness evaluation of Emergency Medical Services (EMS) in terrorist attacks. In the quantitative phase (item reduction), for validity of tool face, content and construct validity, were performed; for tool reliability, the test and retest and intra-class correlation coefficient were evaluated. RESULTS: At the first stage, 7 main categories and 16 subcategories were extracted from the data, the main categories including “Policy and Planning”, “Education and Exercise “,“ Surge Capacity”, “Safety and Security”, “Command, Control and Coordination”, “Information and Communication Management “and “Response Operations Management”. The initial item pool included 160 items that were reduced to 110 after assessment of validity (face, content and construct). intra-class correlation coefficient (ICC = 0.71) examination and Pearson correlation test (r = 0.81) indicated that the tool was also reliable. CONCLUSION: The research findings provide a new perspective to understand the preparedness of pre-hospital emergency medical services for terrorist attacks. The existing 110-item tool can evaluate preparedness of pre-hospital emergency medical services for terrorist attacks through collecting data with appropriate validity and reliability.
format Online
Article
Text
id pubmed-9441090
institution National Center for Biotechnology Information
language English
publishDate 2022
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-94410902022-09-05 Design and validation of a preparedness evaluation tool of pre-hospital emergency medical services for terrorist attacks: a mixed method study Miraki, Sadegh Molavi-Taleghani, Yasamin Amiresmaeili, Mohammadreza Nekoei-Moghadam, Mahmood Sheikhbardsiri, Hojjat BMC Emerg Med Research INTRODUCTION: Terrorist attacks are one of the human problems that affect many countries, leaving behind a huge toll of disabilities and deaths. The aim of this study was to use a mixed-method analysis to design and validate an evaluation tool for pre-hospital emergency medical services for terrorist attacks. METHODS: The present study is a mixed-method (qualitative and quantitative) study that was conducted in two phases. In the qualitative phase (item generation), semi-structured interviews were conducted with 34 Iranian emergency medical technicians who were selected through a purposive sampling method and a scoping literature review was conducted to generate an item pool for the preparedness evaluation of Emergency Medical Services (EMS) in terrorist attacks. In the quantitative phase (item reduction), for validity of tool face, content and construct validity, were performed; for tool reliability, the test and retest and intra-class correlation coefficient were evaluated. RESULTS: At the first stage, 7 main categories and 16 subcategories were extracted from the data, the main categories including “Policy and Planning”, “Education and Exercise “,“ Surge Capacity”, “Safety and Security”, “Command, Control and Coordination”, “Information and Communication Management “and “Response Operations Management”. The initial item pool included 160 items that were reduced to 110 after assessment of validity (face, content and construct). intra-class correlation coefficient (ICC = 0.71) examination and Pearson correlation test (r = 0.81) indicated that the tool was also reliable. CONCLUSION: The research findings provide a new perspective to understand the preparedness of pre-hospital emergency medical services for terrorist attacks. The existing 110-item tool can evaluate preparedness of pre-hospital emergency medical services for terrorist attacks through collecting data with appropriate validity and reliability. BioMed Central 2022-09-03 /pmc/articles/PMC9441090/ /pubmed/36057563 http://dx.doi.org/10.1186/s12873-022-00712-7 Text en © The Author(s) 2022 https://creativecommons.org/licenses/by/4.0/Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data.
spellingShingle Research
Miraki, Sadegh
Molavi-Taleghani, Yasamin
Amiresmaeili, Mohammadreza
Nekoei-Moghadam, Mahmood
Sheikhbardsiri, Hojjat
Design and validation of a preparedness evaluation tool of pre-hospital emergency medical services for terrorist attacks: a mixed method study
title Design and validation of a preparedness evaluation tool of pre-hospital emergency medical services for terrorist attacks: a mixed method study
title_full Design and validation of a preparedness evaluation tool of pre-hospital emergency medical services for terrorist attacks: a mixed method study
title_fullStr Design and validation of a preparedness evaluation tool of pre-hospital emergency medical services for terrorist attacks: a mixed method study
title_full_unstemmed Design and validation of a preparedness evaluation tool of pre-hospital emergency medical services for terrorist attacks: a mixed method study
title_short Design and validation of a preparedness evaluation tool of pre-hospital emergency medical services for terrorist attacks: a mixed method study
title_sort design and validation of a preparedness evaluation tool of pre-hospital emergency medical services for terrorist attacks: a mixed method study
topic Research
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9441090/
https://www.ncbi.nlm.nih.gov/pubmed/36057563
http://dx.doi.org/10.1186/s12873-022-00712-7
work_keys_str_mv AT mirakisadegh designandvalidationofapreparednessevaluationtoolofprehospitalemergencymedicalservicesforterroristattacksamixedmethodstudy
AT molavitaleghaniyasamin designandvalidationofapreparednessevaluationtoolofprehospitalemergencymedicalservicesforterroristattacksamixedmethodstudy
AT amiresmaeilimohammadreza designandvalidationofapreparednessevaluationtoolofprehospitalemergencymedicalservicesforterroristattacksamixedmethodstudy
AT nekoeimoghadammahmood designandvalidationofapreparednessevaluationtoolofprehospitalemergencymedicalservicesforterroristattacksamixedmethodstudy
AT sheikhbardsirihojjat designandvalidationofapreparednessevaluationtoolofprehospitalemergencymedicalservicesforterroristattacksamixedmethodstudy