Cargando…

Provision of injectable contraceptives by community health workers in sub-Saharan Africa: a systematic review of safety, acceptability and effectiveness

BACKGROUND: Injectable contraceptives are the most popular method of contraception in sub-Saharan Africa (SSA), but their availability in clinical settings has been severely limited, despite the scarcity of health care providers and limited access to health facilities. WHO and USAID have endorsed th...

Descripción completa

Detalles Bibliográficos
Autores principales: Ayuk, Besong Eric, Yankam, Brenda Mbouamba, Saah, Farrukh Ishaque, Bain, Luchuo Engelbert
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2022
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9446834/
https://www.ncbi.nlm.nih.gov/pubmed/36064408
http://dx.doi.org/10.1186/s12960-022-00763-8
_version_ 1784783727483682816
author Ayuk, Besong Eric
Yankam, Brenda Mbouamba
Saah, Farrukh Ishaque
Bain, Luchuo Engelbert
author_facet Ayuk, Besong Eric
Yankam, Brenda Mbouamba
Saah, Farrukh Ishaque
Bain, Luchuo Engelbert
author_sort Ayuk, Besong Eric
collection PubMed
description BACKGROUND: Injectable contraceptives are the most popular method of contraception in sub-Saharan Africa (SSA), but their availability in clinical settings has been severely limited, despite the scarcity of health care providers and limited access to health facilities. WHO and USAID have endorsed the community-based distribution of injectable contraceptives as a promising option for improving access to family planning services and expanding the method mix for women who want to limit the number of births. Studies have shown that community health workers (CHWs) can provide women with injectable contraceptives that meet acceptable quality standards. The goal of this study is to identify, evaluate and synthesize evidence supporting the use of community-based administration of injectable contraceptives in SSA. METHODS: This review's guidance was based on a previously developed protocol. Nine international electronic databases and the websites of organizations known to support community-based reproductive health initiatives in SSA were searched systemically. Experts in this area were also contacted for the identification of unpublished literature and ongoing studies. The reference lists of eligible studies were reviewed. The Effective Public Practice Project tool was used to assess the quality and risk of bias in eligible studies. Data were extracted and analysed using a custom data extraction form and a narrative synthesis. RESULTS: The search strategy identified a total of 1358 studies with 12 studies meeting the inclusion criteria. One unpublished study was provided by an expert making a total of 13 studies. The results showed that irrespective of the study designs, well-trained CHWs can competently administer injectable contraceptives safely and community-based delivery of injectable contraceptives is acceptable in SSA. Also, the use of community health workers in the provision of depot-medroxyprogesterone acetate expanded access to inhabitants of hard-to-reach areas and led to an overall uptake of injectable contraceptives as well as family planning. Studies that compared CHWs to clinic-based providers revealed equivalent or higher levels of performance in favour of CHWs. CONCLUSIONS: The CHWs can competently provide injectable contraceptives within SSA communities if appropriately trained and supervised. Hence, SSA policymakers should give this initiative due consideration as a way of improving access to family planning services.
format Online
Article
Text
id pubmed-9446834
institution National Center for Biotechnology Information
language English
publishDate 2022
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-94468342022-09-07 Provision of injectable contraceptives by community health workers in sub-Saharan Africa: a systematic review of safety, acceptability and effectiveness Ayuk, Besong Eric Yankam, Brenda Mbouamba Saah, Farrukh Ishaque Bain, Luchuo Engelbert Hum Resour Health Research BACKGROUND: Injectable contraceptives are the most popular method of contraception in sub-Saharan Africa (SSA), but their availability in clinical settings has been severely limited, despite the scarcity of health care providers and limited access to health facilities. WHO and USAID have endorsed the community-based distribution of injectable contraceptives as a promising option for improving access to family planning services and expanding the method mix for women who want to limit the number of births. Studies have shown that community health workers (CHWs) can provide women with injectable contraceptives that meet acceptable quality standards. The goal of this study is to identify, evaluate and synthesize evidence supporting the use of community-based administration of injectable contraceptives in SSA. METHODS: This review's guidance was based on a previously developed protocol. Nine international electronic databases and the websites of organizations known to support community-based reproductive health initiatives in SSA were searched systemically. Experts in this area were also contacted for the identification of unpublished literature and ongoing studies. The reference lists of eligible studies were reviewed. The Effective Public Practice Project tool was used to assess the quality and risk of bias in eligible studies. Data were extracted and analysed using a custom data extraction form and a narrative synthesis. RESULTS: The search strategy identified a total of 1358 studies with 12 studies meeting the inclusion criteria. One unpublished study was provided by an expert making a total of 13 studies. The results showed that irrespective of the study designs, well-trained CHWs can competently administer injectable contraceptives safely and community-based delivery of injectable contraceptives is acceptable in SSA. Also, the use of community health workers in the provision of depot-medroxyprogesterone acetate expanded access to inhabitants of hard-to-reach areas and led to an overall uptake of injectable contraceptives as well as family planning. Studies that compared CHWs to clinic-based providers revealed equivalent or higher levels of performance in favour of CHWs. CONCLUSIONS: The CHWs can competently provide injectable contraceptives within SSA communities if appropriately trained and supervised. Hence, SSA policymakers should give this initiative due consideration as a way of improving access to family planning services. BioMed Central 2022-09-05 /pmc/articles/PMC9446834/ /pubmed/36064408 http://dx.doi.org/10.1186/s12960-022-00763-8 Text en © The Author(s) 2022 https://creativecommons.org/licenses/by/4.0/Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data.
spellingShingle Research
Ayuk, Besong Eric
Yankam, Brenda Mbouamba
Saah, Farrukh Ishaque
Bain, Luchuo Engelbert
Provision of injectable contraceptives by community health workers in sub-Saharan Africa: a systematic review of safety, acceptability and effectiveness
title Provision of injectable contraceptives by community health workers in sub-Saharan Africa: a systematic review of safety, acceptability and effectiveness
title_full Provision of injectable contraceptives by community health workers in sub-Saharan Africa: a systematic review of safety, acceptability and effectiveness
title_fullStr Provision of injectable contraceptives by community health workers in sub-Saharan Africa: a systematic review of safety, acceptability and effectiveness
title_full_unstemmed Provision of injectable contraceptives by community health workers in sub-Saharan Africa: a systematic review of safety, acceptability and effectiveness
title_short Provision of injectable contraceptives by community health workers in sub-Saharan Africa: a systematic review of safety, acceptability and effectiveness
title_sort provision of injectable contraceptives by community health workers in sub-saharan africa: a systematic review of safety, acceptability and effectiveness
topic Research
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9446834/
https://www.ncbi.nlm.nih.gov/pubmed/36064408
http://dx.doi.org/10.1186/s12960-022-00763-8
work_keys_str_mv AT ayukbesongeric provisionofinjectablecontraceptivesbycommunityhealthworkersinsubsaharanafricaasystematicreviewofsafetyacceptabilityandeffectiveness
AT yankambrendambouamba provisionofinjectablecontraceptivesbycommunityhealthworkersinsubsaharanafricaasystematicreviewofsafetyacceptabilityandeffectiveness
AT saahfarrukhishaque provisionofinjectablecontraceptivesbycommunityhealthworkersinsubsaharanafricaasystematicreviewofsafetyacceptabilityandeffectiveness
AT bainluchuoengelbert provisionofinjectablecontraceptivesbycommunityhealthworkersinsubsaharanafricaasystematicreviewofsafetyacceptabilityandeffectiveness