Cargando…
The association between dietary vitamin C intake and periodontitis: result from the NHANES (2009–2014)
BACKGROUND: The purpose of this study was to investigate whether periodontitis is associated with dietary vitamin C intake, using data from The National Health and Nutrition Examination Survey (NHANES) 2009–2014. METHODS: The study included 5145 adults (age ≥ 30 years) with periodontitis as a dichot...
Autores principales: | , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2022
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9454137/ https://www.ncbi.nlm.nih.gov/pubmed/36076176 http://dx.doi.org/10.1186/s12903-022-02416-7 |
_version_ | 1784785286658523136 |
---|---|
author | Li, Wei Song, Jukun Chen, Zhu |
author_facet | Li, Wei Song, Jukun Chen, Zhu |
author_sort | Li, Wei |
collection | PubMed |
description | BACKGROUND: The purpose of this study was to investigate whether periodontitis is associated with dietary vitamin C intake, using data from The National Health and Nutrition Examination Survey (NHANES) 2009–2014. METHODS: The study included 5145 adults (age ≥ 30 years) with periodontitis as a dichotomous variable and daily intake of vitamin C as a continuous variable. Multiple sets of covariates, such as age, sex, number of flossing, etc., were selected. Using EmpowerStats version 3.0, multivariate logistic regression analysis and hierarchical analysis were performed on the data, and curve fitting graphs were made. RESULTS: There were no statistically significant differences (P > 0.05) between the four dietary vitamin C intake groups (quartiles, Q1–Q4) and covariates (drinking alcohol and hypertension). The low VC intake group (Q1) was more prone to periodontitis than Q2, Q3, and Q4 (all OR < 1.00). A threshold nonlinear association was found between vitamin C (mg) log10 transformation and periodontitis in a generalized additive model (GAM) (P = 0.01). CONCLUSION: The relationship between dietary vitamin C intake and the likelihood of periodontitis was non-linear. The smallest periodontitis index occurred when dietary vitamin C intake was 158.49 mg. Too little or too much vitamin C intake increases periodontitis. |
format | Online Article Text |
id | pubmed-9454137 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2022 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-94541372022-09-09 The association between dietary vitamin C intake and periodontitis: result from the NHANES (2009–2014) Li, Wei Song, Jukun Chen, Zhu BMC Oral Health Research BACKGROUND: The purpose of this study was to investigate whether periodontitis is associated with dietary vitamin C intake, using data from The National Health and Nutrition Examination Survey (NHANES) 2009–2014. METHODS: The study included 5145 adults (age ≥ 30 years) with periodontitis as a dichotomous variable and daily intake of vitamin C as a continuous variable. Multiple sets of covariates, such as age, sex, number of flossing, etc., were selected. Using EmpowerStats version 3.0, multivariate logistic regression analysis and hierarchical analysis were performed on the data, and curve fitting graphs were made. RESULTS: There were no statistically significant differences (P > 0.05) between the four dietary vitamin C intake groups (quartiles, Q1–Q4) and covariates (drinking alcohol and hypertension). The low VC intake group (Q1) was more prone to periodontitis than Q2, Q3, and Q4 (all OR < 1.00). A threshold nonlinear association was found between vitamin C (mg) log10 transformation and periodontitis in a generalized additive model (GAM) (P = 0.01). CONCLUSION: The relationship between dietary vitamin C intake and the likelihood of periodontitis was non-linear. The smallest periodontitis index occurred when dietary vitamin C intake was 158.49 mg. Too little or too much vitamin C intake increases periodontitis. BioMed Central 2022-09-08 /pmc/articles/PMC9454137/ /pubmed/36076176 http://dx.doi.org/10.1186/s12903-022-02416-7 Text en © The Author(s) 2022 https://creativecommons.org/licenses/by/4.0/Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data. |
spellingShingle | Research Li, Wei Song, Jukun Chen, Zhu The association between dietary vitamin C intake and periodontitis: result from the NHANES (2009–2014) |
title | The association between dietary vitamin C intake and periodontitis: result from the NHANES (2009–2014) |
title_full | The association between dietary vitamin C intake and periodontitis: result from the NHANES (2009–2014) |
title_fullStr | The association between dietary vitamin C intake and periodontitis: result from the NHANES (2009–2014) |
title_full_unstemmed | The association between dietary vitamin C intake and periodontitis: result from the NHANES (2009–2014) |
title_short | The association between dietary vitamin C intake and periodontitis: result from the NHANES (2009–2014) |
title_sort | association between dietary vitamin c intake and periodontitis: result from the nhanes (2009–2014) |
topic | Research |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9454137/ https://www.ncbi.nlm.nih.gov/pubmed/36076176 http://dx.doi.org/10.1186/s12903-022-02416-7 |
work_keys_str_mv | AT liwei theassociationbetweendietaryvitamincintakeandperiodontitisresultfromthenhanes20092014 AT songjukun theassociationbetweendietaryvitamincintakeandperiodontitisresultfromthenhanes20092014 AT chenzhu theassociationbetweendietaryvitamincintakeandperiodontitisresultfromthenhanes20092014 AT liwei associationbetweendietaryvitamincintakeandperiodontitisresultfromthenhanes20092014 AT songjukun associationbetweendietaryvitamincintakeandperiodontitisresultfromthenhanes20092014 AT chenzhu associationbetweendietaryvitamincintakeandperiodontitisresultfromthenhanes20092014 |