Cargando…
A Lupin (Lupinus angustifolius) Protein Hydrolysate Exerts Anxiolytic-Like Effects in Western Diet-Fed ApoE(−/−) Mice
Anxiety is the most prevalent psychiatric disorder worldwide, causing a substantial economic burden due to the associated healthcare costs. Given that commercial anxiolytic treatments may cause important side effects and have medical restrictions for prescription and high costs, the search for new n...
Autores principales: | , , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
MDPI
2022
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9456304/ https://www.ncbi.nlm.nih.gov/pubmed/36077225 http://dx.doi.org/10.3390/ijms23179828 |
_version_ | 1784785783206445056 |
---|---|
author | Santos-Sánchez, Guillermo Ponce-España, Eduardo López, Juan Carlos Álvarez-Sánchez, Nuria Álvarez-López, Ana Isabel Pedroche, Justo Millán, Francisco Millán-Linares, María Carmen Lardone, Patricia Judith Bejarano, Ignacio Cruz-Chamorro, Ivan Carrillo-Vico, Antonio |
author_facet | Santos-Sánchez, Guillermo Ponce-España, Eduardo López, Juan Carlos Álvarez-Sánchez, Nuria Álvarez-López, Ana Isabel Pedroche, Justo Millán, Francisco Millán-Linares, María Carmen Lardone, Patricia Judith Bejarano, Ignacio Cruz-Chamorro, Ivan Carrillo-Vico, Antonio |
author_sort | Santos-Sánchez, Guillermo |
collection | PubMed |
description | Anxiety is the most prevalent psychiatric disorder worldwide, causing a substantial economic burden due to the associated healthcare costs. Given that commercial anxiolytic treatments may cause important side effects and have medical restrictions for prescription and high costs, the search for new natural and safer treatments is gaining attention. Since lupin protein hydrolysate (LPH) has been shown to be safe and exert anti-inflammatory and antioxidant effects, key risk factors for the anxiety process and memory impairment, we evaluated in this study the potential effects of LPH on anxiety and spatial memory in a Western diet (WD)-induced anxiety model in ApoE(−/−) mice. We showed that 20.86% of the 278 identified LPH peptides have biological activity related to anxiolytic/analgesic effects; the principal motifs found were the following: VPL, PGP, YL, and GQ. Moreover, 14 weeks of intragastrical LPH treatment (100 mg/kg) restored the WD-induced anxiety effects, reestablishing the anxiety levels observed in the standard diet (SD)-fed mice since they spent less time in the anxiety zones of the elevated plus maze (EPM). Furthermore, a significant increase in the number of head dips was recorded in LPH-treated mice, which indicates a greater exploration capacity and less fear due to lower levels of anxiety. Interestingly, the LPH group showed similar thigmotaxis, a well-established indicator of animal anxiety and fear, to the SD group, counteracting the WD effect. This is the first study to show that LPH treatment has anxiolytic effects, pointing to LPH as a potential component of future nutritional therapies in patients with anxiety. |
format | Online Article Text |
id | pubmed-9456304 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2022 |
publisher | MDPI |
record_format | MEDLINE/PubMed |
spelling | pubmed-94563042022-09-09 A Lupin (Lupinus angustifolius) Protein Hydrolysate Exerts Anxiolytic-Like Effects in Western Diet-Fed ApoE(−/−) Mice Santos-Sánchez, Guillermo Ponce-España, Eduardo López, Juan Carlos Álvarez-Sánchez, Nuria Álvarez-López, Ana Isabel Pedroche, Justo Millán, Francisco Millán-Linares, María Carmen Lardone, Patricia Judith Bejarano, Ignacio Cruz-Chamorro, Ivan Carrillo-Vico, Antonio Int J Mol Sci Article Anxiety is the most prevalent psychiatric disorder worldwide, causing a substantial economic burden due to the associated healthcare costs. Given that commercial anxiolytic treatments may cause important side effects and have medical restrictions for prescription and high costs, the search for new natural and safer treatments is gaining attention. Since lupin protein hydrolysate (LPH) has been shown to be safe and exert anti-inflammatory and antioxidant effects, key risk factors for the anxiety process and memory impairment, we evaluated in this study the potential effects of LPH on anxiety and spatial memory in a Western diet (WD)-induced anxiety model in ApoE(−/−) mice. We showed that 20.86% of the 278 identified LPH peptides have biological activity related to anxiolytic/analgesic effects; the principal motifs found were the following: VPL, PGP, YL, and GQ. Moreover, 14 weeks of intragastrical LPH treatment (100 mg/kg) restored the WD-induced anxiety effects, reestablishing the anxiety levels observed in the standard diet (SD)-fed mice since they spent less time in the anxiety zones of the elevated plus maze (EPM). Furthermore, a significant increase in the number of head dips was recorded in LPH-treated mice, which indicates a greater exploration capacity and less fear due to lower levels of anxiety. Interestingly, the LPH group showed similar thigmotaxis, a well-established indicator of animal anxiety and fear, to the SD group, counteracting the WD effect. This is the first study to show that LPH treatment has anxiolytic effects, pointing to LPH as a potential component of future nutritional therapies in patients with anxiety. MDPI 2022-08-29 /pmc/articles/PMC9456304/ /pubmed/36077225 http://dx.doi.org/10.3390/ijms23179828 Text en © 2022 by the authors. https://creativecommons.org/licenses/by/4.0/Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/). |
spellingShingle | Article Santos-Sánchez, Guillermo Ponce-España, Eduardo López, Juan Carlos Álvarez-Sánchez, Nuria Álvarez-López, Ana Isabel Pedroche, Justo Millán, Francisco Millán-Linares, María Carmen Lardone, Patricia Judith Bejarano, Ignacio Cruz-Chamorro, Ivan Carrillo-Vico, Antonio A Lupin (Lupinus angustifolius) Protein Hydrolysate Exerts Anxiolytic-Like Effects in Western Diet-Fed ApoE(−/−) Mice |
title | A Lupin (Lupinus
angustifolius) Protein Hydrolysate Exerts Anxiolytic-Like Effects in Western Diet-Fed ApoE(−/−) Mice |
title_full | A Lupin (Lupinus
angustifolius) Protein Hydrolysate Exerts Anxiolytic-Like Effects in Western Diet-Fed ApoE(−/−) Mice |
title_fullStr | A Lupin (Lupinus
angustifolius) Protein Hydrolysate Exerts Anxiolytic-Like Effects in Western Diet-Fed ApoE(−/−) Mice |
title_full_unstemmed | A Lupin (Lupinus
angustifolius) Protein Hydrolysate Exerts Anxiolytic-Like Effects in Western Diet-Fed ApoE(−/−) Mice |
title_short | A Lupin (Lupinus
angustifolius) Protein Hydrolysate Exerts Anxiolytic-Like Effects in Western Diet-Fed ApoE(−/−) Mice |
title_sort | lupin (lupinus
angustifolius) protein hydrolysate exerts anxiolytic-like effects in western diet-fed apoe(−/−) mice |
topic | Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9456304/ https://www.ncbi.nlm.nih.gov/pubmed/36077225 http://dx.doi.org/10.3390/ijms23179828 |
work_keys_str_mv | AT santossanchezguillermo alupinlupinusangustifoliusproteinhydrolysateexertsanxiolyticlikeeffectsinwesterndietfedapoemice AT ponceespanaeduardo alupinlupinusangustifoliusproteinhydrolysateexertsanxiolyticlikeeffectsinwesterndietfedapoemice AT lopezjuancarlos alupinlupinusangustifoliusproteinhydrolysateexertsanxiolyticlikeeffectsinwesterndietfedapoemice AT alvarezsancheznuria alupinlupinusangustifoliusproteinhydrolysateexertsanxiolyticlikeeffectsinwesterndietfedapoemice AT alvarezlopezanaisabel alupinlupinusangustifoliusproteinhydrolysateexertsanxiolyticlikeeffectsinwesterndietfedapoemice AT pedrochejusto alupinlupinusangustifoliusproteinhydrolysateexertsanxiolyticlikeeffectsinwesterndietfedapoemice AT millanfrancisco alupinlupinusangustifoliusproteinhydrolysateexertsanxiolyticlikeeffectsinwesterndietfedapoemice AT millanlinaresmariacarmen alupinlupinusangustifoliusproteinhydrolysateexertsanxiolyticlikeeffectsinwesterndietfedapoemice AT lardonepatriciajudith alupinlupinusangustifoliusproteinhydrolysateexertsanxiolyticlikeeffectsinwesterndietfedapoemice AT bejaranoignacio alupinlupinusangustifoliusproteinhydrolysateexertsanxiolyticlikeeffectsinwesterndietfedapoemice AT cruzchamorroivan alupinlupinusangustifoliusproteinhydrolysateexertsanxiolyticlikeeffectsinwesterndietfedapoemice AT carrillovicoantonio alupinlupinusangustifoliusproteinhydrolysateexertsanxiolyticlikeeffectsinwesterndietfedapoemice AT santossanchezguillermo lupinlupinusangustifoliusproteinhydrolysateexertsanxiolyticlikeeffectsinwesterndietfedapoemice AT ponceespanaeduardo lupinlupinusangustifoliusproteinhydrolysateexertsanxiolyticlikeeffectsinwesterndietfedapoemice AT lopezjuancarlos lupinlupinusangustifoliusproteinhydrolysateexertsanxiolyticlikeeffectsinwesterndietfedapoemice AT alvarezsancheznuria lupinlupinusangustifoliusproteinhydrolysateexertsanxiolyticlikeeffectsinwesterndietfedapoemice AT alvarezlopezanaisabel lupinlupinusangustifoliusproteinhydrolysateexertsanxiolyticlikeeffectsinwesterndietfedapoemice AT pedrochejusto lupinlupinusangustifoliusproteinhydrolysateexertsanxiolyticlikeeffectsinwesterndietfedapoemice AT millanfrancisco lupinlupinusangustifoliusproteinhydrolysateexertsanxiolyticlikeeffectsinwesterndietfedapoemice AT millanlinaresmariacarmen lupinlupinusangustifoliusproteinhydrolysateexertsanxiolyticlikeeffectsinwesterndietfedapoemice AT lardonepatriciajudith lupinlupinusangustifoliusproteinhydrolysateexertsanxiolyticlikeeffectsinwesterndietfedapoemice AT bejaranoignacio lupinlupinusangustifoliusproteinhydrolysateexertsanxiolyticlikeeffectsinwesterndietfedapoemice AT cruzchamorroivan lupinlupinusangustifoliusproteinhydrolysateexertsanxiolyticlikeeffectsinwesterndietfedapoemice AT carrillovicoantonio lupinlupinusangustifoliusproteinhydrolysateexertsanxiolyticlikeeffectsinwesterndietfedapoemice |