Cargando…

A Lupin (Lupinus angustifolius) Protein Hydrolysate Exerts Anxiolytic-Like Effects in Western Diet-Fed ApoE(−/−) Mice

Anxiety is the most prevalent psychiatric disorder worldwide, causing a substantial economic burden due to the associated healthcare costs. Given that commercial anxiolytic treatments may cause important side effects and have medical restrictions for prescription and high costs, the search for new n...

Descripción completa

Detalles Bibliográficos
Autores principales: Santos-Sánchez, Guillermo, Ponce-España, Eduardo, López, Juan Carlos, Álvarez-Sánchez, Nuria, Álvarez-López, Ana Isabel, Pedroche, Justo, Millán, Francisco, Millán-Linares, María Carmen, Lardone, Patricia Judith, Bejarano, Ignacio, Cruz-Chamorro, Ivan, Carrillo-Vico, Antonio
Formato: Online Artículo Texto
Lenguaje:English
Publicado: MDPI 2022
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9456304/
https://www.ncbi.nlm.nih.gov/pubmed/36077225
http://dx.doi.org/10.3390/ijms23179828
_version_ 1784785783206445056
author Santos-Sánchez, Guillermo
Ponce-España, Eduardo
López, Juan Carlos
Álvarez-Sánchez, Nuria
Álvarez-López, Ana Isabel
Pedroche, Justo
Millán, Francisco
Millán-Linares, María Carmen
Lardone, Patricia Judith
Bejarano, Ignacio
Cruz-Chamorro, Ivan
Carrillo-Vico, Antonio
author_facet Santos-Sánchez, Guillermo
Ponce-España, Eduardo
López, Juan Carlos
Álvarez-Sánchez, Nuria
Álvarez-López, Ana Isabel
Pedroche, Justo
Millán, Francisco
Millán-Linares, María Carmen
Lardone, Patricia Judith
Bejarano, Ignacio
Cruz-Chamorro, Ivan
Carrillo-Vico, Antonio
author_sort Santos-Sánchez, Guillermo
collection PubMed
description Anxiety is the most prevalent psychiatric disorder worldwide, causing a substantial economic burden due to the associated healthcare costs. Given that commercial anxiolytic treatments may cause important side effects and have medical restrictions for prescription and high costs, the search for new natural and safer treatments is gaining attention. Since lupin protein hydrolysate (LPH) has been shown to be safe and exert anti-inflammatory and antioxidant effects, key risk factors for the anxiety process and memory impairment, we evaluated in this study the potential effects of LPH on anxiety and spatial memory in a Western diet (WD)-induced anxiety model in ApoE(−/−) mice. We showed that 20.86% of the 278 identified LPH peptides have biological activity related to anxiolytic/analgesic effects; the principal motifs found were the following: VPL, PGP, YL, and GQ. Moreover, 14 weeks of intragastrical LPH treatment (100 mg/kg) restored the WD-induced anxiety effects, reestablishing the anxiety levels observed in the standard diet (SD)-fed mice since they spent less time in the anxiety zones of the elevated plus maze (EPM). Furthermore, a significant increase in the number of head dips was recorded in LPH-treated mice, which indicates a greater exploration capacity and less fear due to lower levels of anxiety. Interestingly, the LPH group showed similar thigmotaxis, a well-established indicator of animal anxiety and fear, to the SD group, counteracting the WD effect. This is the first study to show that LPH treatment has anxiolytic effects, pointing to LPH as a potential component of future nutritional therapies in patients with anxiety.
format Online
Article
Text
id pubmed-9456304
institution National Center for Biotechnology Information
language English
publishDate 2022
publisher MDPI
record_format MEDLINE/PubMed
spelling pubmed-94563042022-09-09 A Lupin (Lupinus angustifolius) Protein Hydrolysate Exerts Anxiolytic-Like Effects in Western Diet-Fed ApoE(−/−) Mice Santos-Sánchez, Guillermo Ponce-España, Eduardo López, Juan Carlos Álvarez-Sánchez, Nuria Álvarez-López, Ana Isabel Pedroche, Justo Millán, Francisco Millán-Linares, María Carmen Lardone, Patricia Judith Bejarano, Ignacio Cruz-Chamorro, Ivan Carrillo-Vico, Antonio Int J Mol Sci Article Anxiety is the most prevalent psychiatric disorder worldwide, causing a substantial economic burden due to the associated healthcare costs. Given that commercial anxiolytic treatments may cause important side effects and have medical restrictions for prescription and high costs, the search for new natural and safer treatments is gaining attention. Since lupin protein hydrolysate (LPH) has been shown to be safe and exert anti-inflammatory and antioxidant effects, key risk factors for the anxiety process and memory impairment, we evaluated in this study the potential effects of LPH on anxiety and spatial memory in a Western diet (WD)-induced anxiety model in ApoE(−/−) mice. We showed that 20.86% of the 278 identified LPH peptides have biological activity related to anxiolytic/analgesic effects; the principal motifs found were the following: VPL, PGP, YL, and GQ. Moreover, 14 weeks of intragastrical LPH treatment (100 mg/kg) restored the WD-induced anxiety effects, reestablishing the anxiety levels observed in the standard diet (SD)-fed mice since they spent less time in the anxiety zones of the elevated plus maze (EPM). Furthermore, a significant increase in the number of head dips was recorded in LPH-treated mice, which indicates a greater exploration capacity and less fear due to lower levels of anxiety. Interestingly, the LPH group showed similar thigmotaxis, a well-established indicator of animal anxiety and fear, to the SD group, counteracting the WD effect. This is the first study to show that LPH treatment has anxiolytic effects, pointing to LPH as a potential component of future nutritional therapies in patients with anxiety. MDPI 2022-08-29 /pmc/articles/PMC9456304/ /pubmed/36077225 http://dx.doi.org/10.3390/ijms23179828 Text en © 2022 by the authors. https://creativecommons.org/licenses/by/4.0/Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
spellingShingle Article
Santos-Sánchez, Guillermo
Ponce-España, Eduardo
López, Juan Carlos
Álvarez-Sánchez, Nuria
Álvarez-López, Ana Isabel
Pedroche, Justo
Millán, Francisco
Millán-Linares, María Carmen
Lardone, Patricia Judith
Bejarano, Ignacio
Cruz-Chamorro, Ivan
Carrillo-Vico, Antonio
A Lupin (Lupinus angustifolius) Protein Hydrolysate Exerts Anxiolytic-Like Effects in Western Diet-Fed ApoE(−/−) Mice
title A Lupin (Lupinus angustifolius) Protein Hydrolysate Exerts Anxiolytic-Like Effects in Western Diet-Fed ApoE(−/−) Mice
title_full A Lupin (Lupinus angustifolius) Protein Hydrolysate Exerts Anxiolytic-Like Effects in Western Diet-Fed ApoE(−/−) Mice
title_fullStr A Lupin (Lupinus angustifolius) Protein Hydrolysate Exerts Anxiolytic-Like Effects in Western Diet-Fed ApoE(−/−) Mice
title_full_unstemmed A Lupin (Lupinus angustifolius) Protein Hydrolysate Exerts Anxiolytic-Like Effects in Western Diet-Fed ApoE(−/−) Mice
title_short A Lupin (Lupinus angustifolius) Protein Hydrolysate Exerts Anxiolytic-Like Effects in Western Diet-Fed ApoE(−/−) Mice
title_sort lupin (lupinus angustifolius) protein hydrolysate exerts anxiolytic-like effects in western diet-fed apoe(−/−) mice
topic Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9456304/
https://www.ncbi.nlm.nih.gov/pubmed/36077225
http://dx.doi.org/10.3390/ijms23179828
work_keys_str_mv AT santossanchezguillermo alupinlupinusangustifoliusproteinhydrolysateexertsanxiolyticlikeeffectsinwesterndietfedapoemice
AT ponceespanaeduardo alupinlupinusangustifoliusproteinhydrolysateexertsanxiolyticlikeeffectsinwesterndietfedapoemice
AT lopezjuancarlos alupinlupinusangustifoliusproteinhydrolysateexertsanxiolyticlikeeffectsinwesterndietfedapoemice
AT alvarezsancheznuria alupinlupinusangustifoliusproteinhydrolysateexertsanxiolyticlikeeffectsinwesterndietfedapoemice
AT alvarezlopezanaisabel alupinlupinusangustifoliusproteinhydrolysateexertsanxiolyticlikeeffectsinwesterndietfedapoemice
AT pedrochejusto alupinlupinusangustifoliusproteinhydrolysateexertsanxiolyticlikeeffectsinwesterndietfedapoemice
AT millanfrancisco alupinlupinusangustifoliusproteinhydrolysateexertsanxiolyticlikeeffectsinwesterndietfedapoemice
AT millanlinaresmariacarmen alupinlupinusangustifoliusproteinhydrolysateexertsanxiolyticlikeeffectsinwesterndietfedapoemice
AT lardonepatriciajudith alupinlupinusangustifoliusproteinhydrolysateexertsanxiolyticlikeeffectsinwesterndietfedapoemice
AT bejaranoignacio alupinlupinusangustifoliusproteinhydrolysateexertsanxiolyticlikeeffectsinwesterndietfedapoemice
AT cruzchamorroivan alupinlupinusangustifoliusproteinhydrolysateexertsanxiolyticlikeeffectsinwesterndietfedapoemice
AT carrillovicoantonio alupinlupinusangustifoliusproteinhydrolysateexertsanxiolyticlikeeffectsinwesterndietfedapoemice
AT santossanchezguillermo lupinlupinusangustifoliusproteinhydrolysateexertsanxiolyticlikeeffectsinwesterndietfedapoemice
AT ponceespanaeduardo lupinlupinusangustifoliusproteinhydrolysateexertsanxiolyticlikeeffectsinwesterndietfedapoemice
AT lopezjuancarlos lupinlupinusangustifoliusproteinhydrolysateexertsanxiolyticlikeeffectsinwesterndietfedapoemice
AT alvarezsancheznuria lupinlupinusangustifoliusproteinhydrolysateexertsanxiolyticlikeeffectsinwesterndietfedapoemice
AT alvarezlopezanaisabel lupinlupinusangustifoliusproteinhydrolysateexertsanxiolyticlikeeffectsinwesterndietfedapoemice
AT pedrochejusto lupinlupinusangustifoliusproteinhydrolysateexertsanxiolyticlikeeffectsinwesterndietfedapoemice
AT millanfrancisco lupinlupinusangustifoliusproteinhydrolysateexertsanxiolyticlikeeffectsinwesterndietfedapoemice
AT millanlinaresmariacarmen lupinlupinusangustifoliusproteinhydrolysateexertsanxiolyticlikeeffectsinwesterndietfedapoemice
AT lardonepatriciajudith lupinlupinusangustifoliusproteinhydrolysateexertsanxiolyticlikeeffectsinwesterndietfedapoemice
AT bejaranoignacio lupinlupinusangustifoliusproteinhydrolysateexertsanxiolyticlikeeffectsinwesterndietfedapoemice
AT cruzchamorroivan lupinlupinusangustifoliusproteinhydrolysateexertsanxiolyticlikeeffectsinwesterndietfedapoemice
AT carrillovicoantonio lupinlupinusangustifoliusproteinhydrolysateexertsanxiolyticlikeeffectsinwesterndietfedapoemice