Cargando…

Vitamin D deficiency and vitamin D receptor FokI polymorphism as risk factors for COVID-19

BACKGROUND: Given the sparse data on vitamin D status in pediatric COVID-19, we investigated whether vitamin D deficiency could be a risk factor for susceptibility to COVID-19 in Egyptian children and adolescents. We also investigated whether vitamin D receptor (VDR) FokI polymorphism could be a gen...

Descripción completa

Detalles Bibliográficos
Autores principales: Zeidan, Nancy M. S., Lateef, Hanan M. Abd El, Selim, Dalia M., Razek, Suzan A., Abd-Elrehim, Ghada A. B., Nashat, Mohamed, ElGyar, Noha, Waked, Nevin M., Soliman, Attia A., Elhewala, Ahmed A., Shehab, Mohamed M. M., Ibraheem, Ahmed A. A., Shehata, Hassan, Yousif, Yousif M., Akeel, Nagwa E., Hashem, Mustafa I. A., Ahmed, Amani A., Emam, Ahmed A., Abdelmohsen, Mohamed M., Ahmed, Mohamed F., Saleh, Ahmed S. E., Eltrawy, Heba H., Shahin, Gehan H., Nabil, Rehab M., Hosny, Thoraya A., Abdelhamed, Mohamed R., Afify, Mona R., Alharbi, Mohanned T., Nagshabandi, Mohammed K., Tarabulsi, Muyassar K., Osman, Sherif F., Abd-Elrazek, Amal S. M., Rashad, Manal M., El-Gaaly, Sonya A. A., Gad, Said A. B., Mohamed, Mohamed Y., Abdelkhalek, Khalil, Yousef, Aly A.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Nature Publishing Group US 2022
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9461391/
https://www.ncbi.nlm.nih.gov/pubmed/36085364
http://dx.doi.org/10.1038/s41390-022-02275-6
_version_ 1784786962211667968
author Zeidan, Nancy M. S.
Lateef, Hanan M. Abd El
Selim, Dalia M.
Razek, Suzan A.
Abd-Elrehim, Ghada A. B.
Nashat, Mohamed
ElGyar, Noha
Waked, Nevin M.
Soliman, Attia A.
Elhewala, Ahmed A.
Shehab, Mohamed M. M.
Ibraheem, Ahmed A. A.
Shehata, Hassan
Yousif, Yousif M.
Akeel, Nagwa E.
Hashem, Mustafa I. A.
Ahmed, Amani A.
Emam, Ahmed A.
Abdelmohsen, Mohamed M.
Ahmed, Mohamed F.
Saleh, Ahmed S. E.
Eltrawy, Heba H.
Shahin, Gehan H.
Nabil, Rehab M.
Hosny, Thoraya A.
Abdelhamed, Mohamed R.
Afify, Mona R.
Alharbi, Mohanned T.
Nagshabandi, Mohammed K.
Tarabulsi, Muyassar K.
Osman, Sherif F.
Abd-Elrazek, Amal S. M.
Rashad, Manal M.
El-Gaaly, Sonya A. A.
Gad, Said A. B.
Mohamed, Mohamed Y.
Abdelkhalek, Khalil
Yousef, Aly A.
author_facet Zeidan, Nancy M. S.
Lateef, Hanan M. Abd El
Selim, Dalia M.
Razek, Suzan A.
Abd-Elrehim, Ghada A. B.
Nashat, Mohamed
ElGyar, Noha
Waked, Nevin M.
Soliman, Attia A.
Elhewala, Ahmed A.
Shehab, Mohamed M. M.
Ibraheem, Ahmed A. A.
Shehata, Hassan
Yousif, Yousif M.
Akeel, Nagwa E.
Hashem, Mustafa I. A.
Ahmed, Amani A.
Emam, Ahmed A.
Abdelmohsen, Mohamed M.
Ahmed, Mohamed F.
Saleh, Ahmed S. E.
Eltrawy, Heba H.
Shahin, Gehan H.
Nabil, Rehab M.
Hosny, Thoraya A.
Abdelhamed, Mohamed R.
Afify, Mona R.
Alharbi, Mohanned T.
Nagshabandi, Mohammed K.
Tarabulsi, Muyassar K.
Osman, Sherif F.
Abd-Elrazek, Amal S. M.
Rashad, Manal M.
El-Gaaly, Sonya A. A.
Gad, Said A. B.
Mohamed, Mohamed Y.
Abdelkhalek, Khalil
Yousef, Aly A.
author_sort Zeidan, Nancy M. S.
collection PubMed
description BACKGROUND: Given the sparse data on vitamin D status in pediatric COVID-19, we investigated whether vitamin D deficiency could be a risk factor for susceptibility to COVID-19 in Egyptian children and adolescents. We also investigated whether vitamin D receptor (VDR) FokI polymorphism could be a genetic marker for COVID-19 susceptibility. METHODS: One hundred and eighty patients diagnosed to have COVID‐19 and 200 matched control children and adolescents were recruited. Patients were laboratory confirmed as SARS-CoV-2 positive by real-time RT-PCR. All participants were genotyped for VDR Fok1 polymorphism by RT-PCR. Vitamin D status was defined as sufficient for serum 25(OH) D at least 30 ng/mL, insufficient at 21–29 ng/mL, deficient at <20 ng/mL. RESULTS: Ninety-four patients (52%) had low vitamin D levels with 74 (41%) being deficient and 20 (11%) had vitamin D insufficiency. Vitamin D deficiency was associated with 2.6-fold increased risk for COVID-19 (OR = 2.6; [95% CI 1.96–4.9]; P = 0.002. The FokI FF genotype was significantly more represented in patients compared to control group (OR = 4.05; [95% CI: 1.95–8.55]; P < 0.001). CONCLUSIONS: Vitamin D deficiency and VDR Fok I polymorphism may constitute independent risk factors for susceptibility to COVID-19 in Egyptian children and adolescents. IMPACT: Vitamin D deficiency could be a modifiable risk factor for COVID-19 in children and adolescents because of its immune-modulatory action. To our knowledge, ours is the first such study to investigate the VDR Fok I polymorphism in Caucasian children and adolescents with COVID-19. Vitamin D deficiency and the VDR Fok I polymorphism may constitute independent risk factors for susceptibility to COVID-19 in Egyptian children and adolescents. Clinical trials should be urgently conducted to test for causality and to evaluate the efficacy of vitamin D supplementation for prophylaxis and treatment of COVID-19 taking into account the VDR polymorphisms.
format Online
Article
Text
id pubmed-9461391
institution National Center for Biotechnology Information
language English
publishDate 2022
publisher Nature Publishing Group US
record_format MEDLINE/PubMed
spelling pubmed-94613912022-09-10 Vitamin D deficiency and vitamin D receptor FokI polymorphism as risk factors for COVID-19 Zeidan, Nancy M. S. Lateef, Hanan M. Abd El Selim, Dalia M. Razek, Suzan A. Abd-Elrehim, Ghada A. B. Nashat, Mohamed ElGyar, Noha Waked, Nevin M. Soliman, Attia A. Elhewala, Ahmed A. Shehab, Mohamed M. M. Ibraheem, Ahmed A. A. Shehata, Hassan Yousif, Yousif M. Akeel, Nagwa E. Hashem, Mustafa I. A. Ahmed, Amani A. Emam, Ahmed A. Abdelmohsen, Mohamed M. Ahmed, Mohamed F. Saleh, Ahmed S. E. Eltrawy, Heba H. Shahin, Gehan H. Nabil, Rehab M. Hosny, Thoraya A. Abdelhamed, Mohamed R. Afify, Mona R. Alharbi, Mohanned T. Nagshabandi, Mohammed K. Tarabulsi, Muyassar K. Osman, Sherif F. Abd-Elrazek, Amal S. M. Rashad, Manal M. El-Gaaly, Sonya A. A. Gad, Said A. B. Mohamed, Mohamed Y. Abdelkhalek, Khalil Yousef, Aly A. Pediatr Res Population Study Article BACKGROUND: Given the sparse data on vitamin D status in pediatric COVID-19, we investigated whether vitamin D deficiency could be a risk factor for susceptibility to COVID-19 in Egyptian children and adolescents. We also investigated whether vitamin D receptor (VDR) FokI polymorphism could be a genetic marker for COVID-19 susceptibility. METHODS: One hundred and eighty patients diagnosed to have COVID‐19 and 200 matched control children and adolescents were recruited. Patients were laboratory confirmed as SARS-CoV-2 positive by real-time RT-PCR. All participants were genotyped for VDR Fok1 polymorphism by RT-PCR. Vitamin D status was defined as sufficient for serum 25(OH) D at least 30 ng/mL, insufficient at 21–29 ng/mL, deficient at <20 ng/mL. RESULTS: Ninety-four patients (52%) had low vitamin D levels with 74 (41%) being deficient and 20 (11%) had vitamin D insufficiency. Vitamin D deficiency was associated with 2.6-fold increased risk for COVID-19 (OR = 2.6; [95% CI 1.96–4.9]; P = 0.002. The FokI FF genotype was significantly more represented in patients compared to control group (OR = 4.05; [95% CI: 1.95–8.55]; P < 0.001). CONCLUSIONS: Vitamin D deficiency and VDR Fok I polymorphism may constitute independent risk factors for susceptibility to COVID-19 in Egyptian children and adolescents. IMPACT: Vitamin D deficiency could be a modifiable risk factor for COVID-19 in children and adolescents because of its immune-modulatory action. To our knowledge, ours is the first such study to investigate the VDR Fok I polymorphism in Caucasian children and adolescents with COVID-19. Vitamin D deficiency and the VDR Fok I polymorphism may constitute independent risk factors for susceptibility to COVID-19 in Egyptian children and adolescents. Clinical trials should be urgently conducted to test for causality and to evaluate the efficacy of vitamin D supplementation for prophylaxis and treatment of COVID-19 taking into account the VDR polymorphisms. Nature Publishing Group US 2022-09-09 2023 /pmc/articles/PMC9461391/ /pubmed/36085364 http://dx.doi.org/10.1038/s41390-022-02275-6 Text en © The Author(s) 2022 https://creativecommons.org/licenses/by/4.0/Open Access This article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article’s Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article’s Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/)
spellingShingle Population Study Article
Zeidan, Nancy M. S.
Lateef, Hanan M. Abd El
Selim, Dalia M.
Razek, Suzan A.
Abd-Elrehim, Ghada A. B.
Nashat, Mohamed
ElGyar, Noha
Waked, Nevin M.
Soliman, Attia A.
Elhewala, Ahmed A.
Shehab, Mohamed M. M.
Ibraheem, Ahmed A. A.
Shehata, Hassan
Yousif, Yousif M.
Akeel, Nagwa E.
Hashem, Mustafa I. A.
Ahmed, Amani A.
Emam, Ahmed A.
Abdelmohsen, Mohamed M.
Ahmed, Mohamed F.
Saleh, Ahmed S. E.
Eltrawy, Heba H.
Shahin, Gehan H.
Nabil, Rehab M.
Hosny, Thoraya A.
Abdelhamed, Mohamed R.
Afify, Mona R.
Alharbi, Mohanned T.
Nagshabandi, Mohammed K.
Tarabulsi, Muyassar K.
Osman, Sherif F.
Abd-Elrazek, Amal S. M.
Rashad, Manal M.
El-Gaaly, Sonya A. A.
Gad, Said A. B.
Mohamed, Mohamed Y.
Abdelkhalek, Khalil
Yousef, Aly A.
Vitamin D deficiency and vitamin D receptor FokI polymorphism as risk factors for COVID-19
title Vitamin D deficiency and vitamin D receptor FokI polymorphism as risk factors for COVID-19
title_full Vitamin D deficiency and vitamin D receptor FokI polymorphism as risk factors for COVID-19
title_fullStr Vitamin D deficiency and vitamin D receptor FokI polymorphism as risk factors for COVID-19
title_full_unstemmed Vitamin D deficiency and vitamin D receptor FokI polymorphism as risk factors for COVID-19
title_short Vitamin D deficiency and vitamin D receptor FokI polymorphism as risk factors for COVID-19
title_sort vitamin d deficiency and vitamin d receptor foki polymorphism as risk factors for covid-19
topic Population Study Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9461391/
https://www.ncbi.nlm.nih.gov/pubmed/36085364
http://dx.doi.org/10.1038/s41390-022-02275-6
work_keys_str_mv AT zeidannancyms vitaminddeficiencyandvitamindreceptorfokipolymorphismasriskfactorsforcovid19
AT lateefhananmabdel vitaminddeficiencyandvitamindreceptorfokipolymorphismasriskfactorsforcovid19
AT selimdaliam vitaminddeficiencyandvitamindreceptorfokipolymorphismasriskfactorsforcovid19
AT razeksuzana vitaminddeficiencyandvitamindreceptorfokipolymorphismasriskfactorsforcovid19
AT abdelrehimghadaab vitaminddeficiencyandvitamindreceptorfokipolymorphismasriskfactorsforcovid19
AT nashatmohamed vitaminddeficiencyandvitamindreceptorfokipolymorphismasriskfactorsforcovid19
AT elgyarnoha vitaminddeficiencyandvitamindreceptorfokipolymorphismasriskfactorsforcovid19
AT wakednevinm vitaminddeficiencyandvitamindreceptorfokipolymorphismasriskfactorsforcovid19
AT solimanattiaa vitaminddeficiencyandvitamindreceptorfokipolymorphismasriskfactorsforcovid19
AT elhewalaahmeda vitaminddeficiencyandvitamindreceptorfokipolymorphismasriskfactorsforcovid19
AT shehabmohamedmm vitaminddeficiencyandvitamindreceptorfokipolymorphismasriskfactorsforcovid19
AT ibraheemahmedaa vitaminddeficiencyandvitamindreceptorfokipolymorphismasriskfactorsforcovid19
AT shehatahassan vitaminddeficiencyandvitamindreceptorfokipolymorphismasriskfactorsforcovid19
AT yousifyousifm vitaminddeficiencyandvitamindreceptorfokipolymorphismasriskfactorsforcovid19
AT akeelnagwae vitaminddeficiencyandvitamindreceptorfokipolymorphismasriskfactorsforcovid19
AT hashemmustafaia vitaminddeficiencyandvitamindreceptorfokipolymorphismasriskfactorsforcovid19
AT ahmedamania vitaminddeficiencyandvitamindreceptorfokipolymorphismasriskfactorsforcovid19
AT emamahmeda vitaminddeficiencyandvitamindreceptorfokipolymorphismasriskfactorsforcovid19
AT abdelmohsenmohamedm vitaminddeficiencyandvitamindreceptorfokipolymorphismasriskfactorsforcovid19
AT ahmedmohamedf vitaminddeficiencyandvitamindreceptorfokipolymorphismasriskfactorsforcovid19
AT salehahmedse vitaminddeficiencyandvitamindreceptorfokipolymorphismasriskfactorsforcovid19
AT eltrawyhebah vitaminddeficiencyandvitamindreceptorfokipolymorphismasriskfactorsforcovid19
AT shahingehanh vitaminddeficiencyandvitamindreceptorfokipolymorphismasriskfactorsforcovid19
AT nabilrehabm vitaminddeficiencyandvitamindreceptorfokipolymorphismasriskfactorsforcovid19
AT hosnythorayaa vitaminddeficiencyandvitamindreceptorfokipolymorphismasriskfactorsforcovid19
AT abdelhamedmohamedr vitaminddeficiencyandvitamindreceptorfokipolymorphismasriskfactorsforcovid19
AT afifymonar vitaminddeficiencyandvitamindreceptorfokipolymorphismasriskfactorsforcovid19
AT alharbimohannedt vitaminddeficiencyandvitamindreceptorfokipolymorphismasriskfactorsforcovid19
AT nagshabandimohammedk vitaminddeficiencyandvitamindreceptorfokipolymorphismasriskfactorsforcovid19
AT tarabulsimuyassark vitaminddeficiencyandvitamindreceptorfokipolymorphismasriskfactorsforcovid19
AT osmansheriff vitaminddeficiencyandvitamindreceptorfokipolymorphismasriskfactorsforcovid19
AT abdelrazekamalsm vitaminddeficiencyandvitamindreceptorfokipolymorphismasriskfactorsforcovid19
AT rashadmanalm vitaminddeficiencyandvitamindreceptorfokipolymorphismasriskfactorsforcovid19
AT elgaalysonyaaa vitaminddeficiencyandvitamindreceptorfokipolymorphismasriskfactorsforcovid19
AT gadsaidab vitaminddeficiencyandvitamindreceptorfokipolymorphismasriskfactorsforcovid19
AT mohamedmohamedy vitaminddeficiencyandvitamindreceptorfokipolymorphismasriskfactorsforcovid19
AT abdelkhalekkhalil vitaminddeficiencyandvitamindreceptorfokipolymorphismasriskfactorsforcovid19
AT yousefalya vitaminddeficiencyandvitamindreceptorfokipolymorphismasriskfactorsforcovid19